LXL04_029896 | RubberDandelionOmics

Gene overview

LXL04_029896

Reference: OH-1004 Chr: Chr06 Coordinates: 102979199-102983805 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3915 bp · LXL04_029896|LXL04_029896|OH1004|cDNA

ATGGAAGAAGCCATATACCAGATAGTTACAGAGCTCGAAGCACACCACAACGACTCACATTCACATACTCCCATCACCGAATCAACCCTATTAGCTCTTCAAACCCTCTTAGACTACACACTCGACAAAGATGATCCAATCGAAATCGAAAATCTCTCCGACGAACTCTCCTCCAAGAATCTCTCTCTCGCCTCCTCCCTCCTCCACCCTCTCACCTCCTCAATGGAATCCGGCATACCCCATCGCTCTCTTCTCGCTTC...

CDS

Download CDS FASTA

3915 bp · LXL04_029896|LXL04_029896|OH1004|CDS

ATGGAAGAAGCCATATACCAGATAGTTACAGAGCTCGAAGCACACCACAACGACTCACATTCACATACTCCCATCACCGAATCAACCCTATTAGCTCTTCAAACCCTCTTAGACTACACACTCGACAAAGATGATCCAATCGAAATCGAAAATCTCTCCGACGAACTCTCCTCCAAGAATCTCTCTCTCGCCTCCTCCCTCCTCCACCCTCTCACCTCCTCAATGGAATCCGGCATACCCCATCGCTCTCTTCTCGCTTC...

Protein

Download Protein FASTA

1304 aa · LXL04_029896|LXL04_029896|OH1004|PROTEIN

MEEAIYQIVTELEAHHNDSHSHTPITESTLLALQTLLDYTLDKDDPIEIENLSDELSSKNLSLASSLLHPLTSSMESGIPHRSLLASKVYLSLLLTPNFPVLSLFTPMAFLSLLRTVRRSFKNPQSGPPSGNQGKKKRGGRGGGRSKNTSKNVEEEGEEEREPVREFDVRALFPVLERLHLVLGLIHLGRFPDSLKGLVQTVAEIPVTALDTCGNSANYTKLCNLCSQILSELLKSEHGDKSITAAEVLKSLSSSIIFSK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029896`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029896

Location Chr06:102979199-102983805 (-)

Description Similar to NCAPD3: Condensin-2 complex subunit D3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g15890`	Regulatory subunit of the condensin-2 complex, a complex which establishes mitotic chromosome architecture and is involved in physical rigidity of the chromatid axis (By similarity).	The Arabidopsis CAP-D proteins are required for correct chromatin organisation, growth and fertility.2013 · DOI: 10.1007/s00412-013-0424-y The condensin complexes play distinct roles to ensure normal chromosome morphogenesis during meiotic division in Arabidopsis.2014 · DOI: 10.1111/tpj.12628 The PHD Finger Protein MMD1/DUET Ensures the Progression of Male Meiotic Chromosome Condensation and Directly Regulates the Expression of the Condensin Gene CAP-D3.2016 · DOI: 10.1105/tpc.16.00040

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029896 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000070 mitotic sister chromatid segregation Biological Process

GO:0000278 mitotic cell cycle Biological Process

GO:0006325 chromatin organization Biological Process

GO:0007062 sister chromatid cohesion Biological Process

GO:0007076 mitotic chromosome condensation Biological Process

GO:0009556 microsporogenesis Biological Process

GO:0010032 meiotic chromosome condensation Biological Process

GO:0030261 chromosome condensation Biological Process

GO:0045132 meiotic chromosome segregation Biological Process

GO:0051301 cell division Biological Process

GO:0051307 meiotic chromosome separation Biological Process

GO:0051315 attachment of mitotic spindle microtubules to kinetochore Biological Process

KEGG gene cross-reference

ath:AT4G15890

cel:CELE_Y110A7A.1

hsa:23310

mmu:78658

xla:398742

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.915

Rank 1 · LXL04_029896 · OH-1004

Cytoplasm0.152

Rank 2 · LXL04_029896 · OH-1004

Cell membrane0.024

Rank 3 · LXL04_029896 · OH-1004

Mitochondrion0.015

Rank 4 · LXL04_029896 · OH-1004

Endoplasmic reticulum0.014

Rank 5 · LXL04_029896 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12717.14Cnd1432-540 aa

PF26778.1HEAT_NCAPD3812-900 aa

PF12717.14Cnd1908-1082 aa

PF26779.1HEAT_NCAPD3_21106-1210 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029896	`PF12717.14`	Cnd1	432	540	1.6e-24	87.5
LXL04_029896	`PF26778.1`	HEAT_NCAPD3	812	900	7.9e-18	65.7
LXL04_029896	`PF12717.14`	Cnd1	908	1082	1.6e-24	87.5
LXL04_029896	`PF26779.1`	HEAT_NCAPD3_2	1106	1210	4.4e-35	120.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O24610`	Arabidopsis thaliana	Condensin-2 complex subunit CAP-D3	56.994%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card