LXL04_029873 | RubberDandelionOmics

Gene overview

LXL04_029873

Reference: OH-1004 Chr: Chr06 Coordinates: 102630452-102636730 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3639 bp · LXL04_029873|LXL04_029873|OH1004|cDNA

ATGGCTGCGCAGTTGCTCTTCTGCAACACTCTCGTTGCCCTTCTCATCTTCTTCCTTTCTCCTCTTCTATCAAAATCAGATGATTCGTCGAAAGAGTTGCCTCATTTTTCTTTTAGTTGGCCGGATGATGTTTGGCCGGCCGATGATAATGAATTTTATACCGGTGATAATGTAACTATTAAGGTCAATGTACATGGTAACTACAATCCTGAAGATTTCAAATTCCCTTTCAACCCGGACATCTCAGTGAACGACACAAA...

CDS

Download CDS FASTA

3639 bp · LXL04_029873|LXL04_029873|OH1004|CDS

ATGGCTGCGCAGTTGCTCTTCTGCAACACTCTCGTTGCCCTTCTCATCTTCTTCCTTTCTCCTCTTCTATCAAAATCAGATGATTCGTCGAAAGAGTTGCCTCATTTTTCTTTTAGTTGGCCGGATGATGTTTGGCCGGCCGATGATAATGAATTTTATACCGGTGATAATGTAACTATTAAGGTCAATGTACATGGTAACTACAATCCTGAAGATTTCAAATTCCCTTTCAACCCGGACATCTCAGTGAACGACACAAA...

Protein

Download Protein FASTA

1212 aa · LXL04_029873|LXL04_029873|OH1004|PROTEIN

MAAQLLFCNTLVALLIFFLSPLLSKSDDSSKELPHFSFSWPDDVWPADDNEFYTGDNVTIKVNVHGNYNPEDFKFPFNPDISVNDTKGNSSYITELHSDFGNDTNNWRILFTPIMAGFFHMLITDDHFKVHDTSLNFHVAPAESYIAPQFSFSFEDNRIVYRTGELVRLSATAYYNDNPKTYKYPFNPNMTLSNSIGRDEKMGNSSYITGVYNTFGNDIRDFRIHFIPIMVGHFHIWIHQENLMEGSSLQYDATPAEIYV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029873`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029873

Location Chr06:102630452-102636730 (+)

Description Similar to GEX2: Protein GAMETE EXPRESSED 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g49150`	Protein GAMETE EXPRESSED 2.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029873 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0030036 actin cytoskeleton organization Biological Process

GO:0048235 pollen sperm cell differentiation Biological Process

GO:0061936 fusion of sperm to egg plasma membrane involved in double fertilization forming a zygote and endosperm Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0051015 actin filament binding Molecular Function

KEGG gene cross-reference

ath:AT5G49150

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.505

Rank 1 · LXL04_029873 · OH-1004

Cytoplasm0.213

Rank 2 · LXL04_029873 · OH-1004

Lysosome / Vacuole0.136

Rank 3 · LXL04_029873 · OH-1004

Endoplasmic reticulum0.131

Rank 4 · LXL04_029873 · OH-1004

Extracellular0.130

Rank 5 · LXL04_029873 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23616.2Ig_GEX2_N45-139 aa

PF23616.2Ig_GEX2_N148-251 aa

PF23616.2Ig_GEX2_N262-368 aa

PF00630.26Filamin487-605 aa

PF17963.8Big_9726-799 aa

PF17803.9Cadherin_4727-808 aa

PF28974.1GEX2837-937 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029873	`PF23616.2`	Ig_GEX2_N	45	139	4.8e-71	236.3
LXL04_029873	`PF23616.2`	Ig_GEX2_N	148	251	4.8e-71	236.3
LXL04_029873	`PF23616.2`	Ig_GEX2_N	262	368	4.8e-71	236.3
LXL04_029873	`PF00630.26`	Filamin	487	605	4.4e-16	60.2
LXL04_029873	`PF17963.8`	Big_9	726	799	1.8e-09	39.1
LXL04_029873	`PF17803.9`	Cadherin_4	727	808	4.4e-06	27.8
LXL04_029873	`PF28974.1`	GEX2	837	937	9.4e-42	141.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4K4R6`	Arabidopsis thaliana	Protein GAMETE EXPRESSED 2	44.000%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card