LXL04_029869 | RubberDandelionOmics

Gene overview

LXL04_029869

Reference: OH-1004 Chr: Chr06 Coordinates: 102538283-102540107 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1149 bp · LXL04_029869|LXL04_029869|OH1004|cDNA

ATGATGAAATGTTTCAGTATTTTCAGTTCCAGAACGAAGAGAAGAGGAAAATCTTCACCGGAGCTCCGGGAGCAAAACCCATCAACAAAACCATCCACAAGATTAGTAAAGTCGACAGGATCAATCGTTTCACCAAGAACAATACCGGAATTGTACAGAGAAAAAGGACATAATTTGACCAAGTTTTCGTTTTCAGTGCTCAGAAATGCTACTAATAACTTCAATAGATCGttaaaaatcggagaaggtGGATTCGGGAG...

CDS

Download CDS FASTA

1149 bp · LXL04_029869|LXL04_029869|OH1004|CDS

ATGATGAAATGTTTCAGTATTTTCAGTTCCAGAACGAAGAGAAGAGGAAAATCTTCACCGGAGCTCCGGGAGCAAAACCCATCAACAAAACCATCCACAAGATTAGTAAAGTCGACAGGATCAATCGTTTCACCAAGAACAATACCGGAATTGTACAGAGAAAAAGGACATAATTTGACCAAGTTTTCGTTTTCAGTGCTCAGAAATGCTACTAATAACTTCAATAGATCGTTAAAAATCGGAGAAGGTGGATTCGGGAG...

Protein

Download Protein FASTA

382 aa · LXL04_029869|LXL04_029869|OH1004|PROTEIN

MMKCFSIFSSRTKRRGKSSPELREQNPSTKPSTRLVKSTGSIVSPRTIPELYREKGHNLTKFSFSVLRNATNNFNRSLKIGEGGFGSVYKGSIKPPGGQGEPLVVAIKKLNRNGMQGHKEWLAEVQFLGVVEHPNLVKLLGYCSTDGERGIQRLLVYEYMPNKSLEDHLFSRAFPPIPWKRRLQILHGAAQGLAYLHEGLEIQVIFRDFKSSNVLLDENFNPKLSDFGLAREGPQGDQSHVSTMPVGTYGYAAPEYVETG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029869`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029869

Location Chr06:102538283-102540107 (+)

Description Similar to PBL19: Probable serine/threonine-protein kinase PBL19

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g47070`	May be involved in plant defense signaling.	No verified direct reference in this release
`At4g17660`	May be involved in plant defense signaling.	No verified direct reference in this release
`At3g09830`	Involved in the activation of early immune responses.	The receptor-like cytoplasmic kinase PCRK1 contributes to pattern-triggered immunity against Pseudomonas syringae in Arabidopsis thaliana.2015 · DOI: 10.1111/nph.13345 Functional characterization of PCRK1, a putative protein kinase with a role in immunity.2015 · DOI: 10.1080/15592324.2015.1063759
`At5g03320`	Functions redundantly with PCRK1 in basal resistance against bacterial pathogens and in regulation of plant immunity.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0110900`	Functions downstream of CERK1 in the microbial peptidoglycans (PGNs) and fungal chitin signaling pathways that mediate innate immunity.	OsCERK1 and OsRLCK176 play important roles in peptidoglycan and chitin signaling in rice innate immunity.2014 · DOI: 10.1111/tpj.12710

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029869 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002221 pattern recognition receptor signaling pathway Biological Process

GO:0006952 defense response Biological Process

GO:0009617 response to bacterium Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045087 innate immune response Biological Process

GO:0080142 regulation of salicylic acid biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT3G09830

ath:AT4G17660

ath:AT5G03320

ath:AT5G47070

dosa:Os05g0110900

osa:4337593

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.674

Rank 1 · LXL04_029869 · OH-1004

Cytoplasm0.264

Rank 2 · LXL04_029869 · OH-1004

Nucleus0.239

Rank 3 · LXL04_029869 · OH-1004

Endoplasmic reticulum0.039

Rank 4 · LXL04_029869 · OH-1004

Golgi apparatus0.027

Rank 5 · LXL04_029869 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase76-353 aa

PF07714.24PK_Tyr_Ser-Thr78-355 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029869	`PF00069.32`	Pkinase	76	353	4.5e-45	154.8
LXL04_029869	`PF07714.24`	PK_Tyr_Ser-Thr	78	355	6.5e-47	160.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LTC0`	Arabidopsis thaliana	Probable serine/threonine-protein kinase PBL19	57.743%	Swiss-Prot	strong database homology
`F4JPX3`	Arabidopsis thaliana	Probable serine/threonine-protein kinase PBL20	54.476%	Swiss-Prot	strong database homology
`Q9SF86`	Arabidopsis thaliana	Serine/threonine-protein kinase PCRK1	49.860%	Swiss-Prot	moderate database homology
`Q9LZF8`	Arabidopsis thaliana	Serine/threonine-protein kinase PCRK2	49.733%	Swiss-Prot	moderate database homology
`Q65XV8`	Oryza sativa subsp. japonica	Receptor-like cytoplasmic kinase 176	50.904%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card