LXL04_029865 | RubberDandelionOmics

Gene overview

LXL04_029865

Reference: OH-1004 Chr: Chr06 Coordinates: 102446760-102448248 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1323 bp · LXL04_029865|LXL04_029865|OH1004|cDNA

ATGCGTCAGAAGAAATCAGTCCTTCAGATCGGAGAAGAAACCTCGGATGAAAATCCCAGTTTCAAAGTCCAAATCGCACCAGATTACGATGGACAAAAACCCAGTTTCAAACAAGAATCATCAGCCACAAAACAACCTCAGCTCATGATTCCCCAACACCGTAATTCCCACCGGAAAATTCATCAGAAGTCCTTAGTTTGCTGTTCATCTTCAGACGCCCTTTTAGCCACGAAATCAGTTGTTCTGAAAGTGTTGAAGCT...

CDS

Download CDS FASTA

1323 bp · LXL04_029865|LXL04_029865|OH1004|CDS

ATGCGTCAGAAGAAATCAGTCCTTCAGATCGGAGAAGAAACCTCGGATGAAAATCCCAGTTTCAAAGTCCAAATCGCACCAGATTACGATGGACAAAAACCCAGTTTCAAACAAGAATCATCAGCCACAAAACAACCTCAGCTCATGATTCCCCAACACCGTAATTCCCACCGGAAAATTCATCAGAAGTCCTTAGTTTGCTGTTCATCTTCAGACGCCCTTTTAGCCACGAAATCAGTTGTTCTGAAAGTGTTGAAGCT...

Protein

Download Protein FASTA

440 aa · LXL04_029865|LXL04_029865|OH1004|PROTEIN

MRQKKSVLQIGEETSDENPSFKVQIAPDYDGQKPSFKQESSATKQPQLMIPQHRNSHRKIHQKSLVCCSSSDALLATKSVVLKVLKLNHVKVFWIKAPSRVLILICLPSVYFFSLNHHQSLYLYILFLITLCILILSLLNLPSIRLFIARSLSNMGNASKTSPPVVWSIGTKNQFESSTISGFLVKVYSNGDVYEGEFYKGKCSGSGVYYYNMNGRYEGDWVDQKYDGYGVETWAKGSRYRGQYRQGLRHGYGVYKFFTG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029865`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029865

Location Chr06:102446760-102448248 (+)

Description Similar to PIP5K1: Phosphatidylinositol 4-phosphate 5-kinase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g21980`	Catalyzes the synthesis of phosphatidylinositol 4,5- bisphosphate and phosphatidylinositol 3,4-bisphosphate.	AtPIP5K1, an Arabidopsis thaliana phosphatidylinositol phosphate kinase, synthesizes PtdIns(3,4)P(2) and PtdIns(4,5)P(2) in vitro and is inhibited by phosphorylation.2001 · DOI: 10.1042/0264-6021:3590583
`At2g41210`	Phosphatidylinositol 4-phosphate 5-kinase 5.	No verified direct reference in this release
`At3g56960`	Phosphatidylinositol 4-phosphate 5-kinase 4.	No verified direct reference in this release
`At1g77740`	Possesses phosphatidylinositol (PtdIns) phosphate kinase activity (Probable).	Arabidopsis Rab-E GTPases exhibit a novel interaction with a plasma-membrane phosphatidylinositol-4-phosphate 5-kinase.2009 · DOI: 10.1242/jcs.053488
`At1g60890`	Phosphatidylinositol 4-phosphate 5-kinase 8.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029865 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009827 plant-type cell wall modification Biological Process

GO:0009846 pollen germination Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0046488 phosphatidylinositol metabolic process Biological Process

GO:0046854 phosphatidylinositol phosphate biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016324 apical plasma membrane Cellular Component

GO:0090406 pollen tube Cellular Component

GO:0003785 actin monomer binding Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT1G21980

ath:AT2G41210

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.390

Rank 1 · LXL04_029865 · OH-1004

Nucleus0.379

Rank 2 · LXL04_029865 · OH-1004

Cell membrane0.140

Rank 3 · LXL04_029865 · OH-1004

Endoplasmic reticulum0.080

Rank 4 · LXL04_029865 · OH-1004

Mitochondrion0.070

Rank 5 · LXL04_029865 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02493.27MORN217-239 aa

PF02493.27MORN240-262 aa

PF02493.27MORN263-284 aa

PF02493.27MORN286-308 aa

PF02493.27MORN309-331 aa

PF02493.27MORN332-354 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029865	`PF02493.27`	MORN	217	239	3.4e-37	124.8
LXL04_029865	`PF02493.27`	MORN	240	262	3.4e-37	124.8
LXL04_029865	`PF02493.27`	MORN	263	284	3.4e-37	124.8
LXL04_029865	`PF02493.27`	MORN	286	308	3.4e-37	124.8
LXL04_029865	`PF02493.27`	MORN	309	331	3.4e-37	124.8
LXL04_029865	`PF02493.27`	MORN	332	354	3.4e-37	124.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q56YP2`	Arabidopsis thaliana	Phosphatidylinositol 4-phosphate 5-kinase 1	35.795%	Swiss-Prot	weak database homology
`Q9SLG9`	Arabidopsis thaliana	Phosphatidylinositol 4-phosphate 5-kinase 5	36.782%	Swiss-Prot	weak database homology
`Q9M1K2`	Arabidopsis thaliana	Phosphatidylinositol 4-phosphate 5-kinase 4	33.908%	Swiss-Prot	weak database homology
`Q8L796`	Arabidopsis thaliana	Phosphatidylinositol 4-phosphate 5-kinase 2	32.990%	Swiss-Prot	weak database homology
`Q8RY89`	Arabidopsis thaliana	Phosphatidylinositol 4-phosphate 5-kinase 8	35.393%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card