LXL04_029844 | RubberDandelionOmics

Gene overview

LXL04_029844

Reference: OH-1004 Chr: Chr06 Coordinates: 101721077-101723199 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2049 bp · LXL04_029844|LXL04_029844|OH1004|cDNA

ATGTTGCGATTTATTTCTTATGTGTTGCTTCTCACATGCACCACCATTTTCACCGTCTCTCCTACAAAAGCCGATAATGAACCCAAAACCTACATTGTTCAGTTAACTTTACCCGAAGGCCAAGAATTTTCTCACCCACAAGACTGTGAAGAGTGGTACAAGTCACTTCTGTCTGAAAGTGCTTCCATCTCAAATGATAAACCGATCATGGTTCATATGTACCACCATGTGATGACATGTTTTGCTGCAAAAATGTCGAT...

CDS

Download CDS FASTA

2049 bp · LXL04_029844|LXL04_029844|OH1004|CDS

ATGTTGCGATTTATTTCTTATGTGTTGCTTCTCACATGCACCACCATTTTCACCGTCTCTCCTACAAAAGCCGATAATGAACCCAAAACCTACATTGTTCAGTTAACTTTACCCGAAGGCCAAGAATTTTCTCACCCACAAGACTGTGAAGAGTGGTACAAGTCACTTCTGTCTGAAAGTGCTTCCATCTCAAATGATAAACCGATCATGGTTCATATGTACCACCATGTGATGACATGTTTTGCTGCAAAAATGTCGAT...

Protein

Download Protein FASTA

682 aa · LXL04_029844|LXL04_029844|OH1004|PROTEIN

MLRFISYVLLLTCTTIFTVSPTKADNEPKTYIVQLTLPEGQEFSHPQDCEEWYKSLLSESASISNDKPIMVHMYHHVMTCFAAKMSMHQAKVMENMKGVLSVRCERVYQLHTTHSPQFLGLHQNTGFWKTLNYGKGIIIGILDSGITPGHPSFSDEGVPPPPSRWKGKCEVAGCNNKLIGKRHFQPQTQVEDLQGHGTHTSSTAVGSPVHNANVFGNANGTAMGMAPLAHMAMYTVCYYFCHGSTILAGIDAAIEDGVDV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029844`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_029844`
Location	Chr06:101721077-101723199 (-)
Description	Similar to SBT: Subtilisin-like protease
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_029844` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006508 proteolysis Biological Process GO:0009609 response to symbiotic bacterium Biological Process GO:0009610 response to symbiotic fungus Biological Process GO:0036377 arbuscular mycorrhizal association Biological Process GO:0005576 extracellular region Cellular Component GO:0005615 extracellular space Cellular Component GO:0048046 apoplast Cellular Component GO:0004252 serine-type endopeptidase activity Molecular Function
KEGG gene cross-reference	mtr:11443095 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.654

Rank 1 · LXL04_029844 · OH-1004

Lysosome / Vacuole0.124

Rank 2 · LXL04_029844 · OH-1004

Cytoplasm0.080

Rank 3 · LXL04_029844 · OH-1004

Cell membrane0.078

Rank 4 · LXL04_029844 · OH-1004

Endoplasmic reticulum0.067

Rank 5 · LXL04_029844 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05922.22Inhibitor_I930-111 aa

PF00082.28Peptidase_S8134-526 aa

PF02225.28PA353-432 aa

PF17766.8fn3_6605-669 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029844	`PF05922.22`	Inhibitor_I9	30	111	6.2e-10	40.3
LXL04_029844	`PF00082.28`	Peptidase_S8	134	526	1.5e-34	120.4
LXL04_029844	`PF02225.28`	PA	353	432	5e-09	36.9
LXL04_029844	`PF17766.8`	fn3_6	605	669	3.9e-09	37.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card