LXL04_029828 | RubberDandelionOmics

Gene overview

LXL04_029828

Reference: OH-1004 Chr: Chr06 Coordinates: 101342837-101344450 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1614 bp · LXL04_029828|LXL04_029828|OH1004|cDNA

ATGATGCAGATCGGTGCGACACTTCCGGCGAACAATATTCACATGTTTCAGGGAAGACACTTTTCTGGTGGCTTTAGTTATAGGTCATCGTTGAATCCTTCTGGAAGAGAGTGTTCCACGAAGAACATGATGAAAGCCACCACCGTGTCGGCCGCCGTATCAACCCGCCAACACATCTCTAATCTTGACAAATTACTCGGTACAGAAGTACCGCAGGTGATTCTGACTGAGCCGGAACTCGCTAAGGAGGATATTTCCGA...

CDS

Download CDS FASTA

1614 bp · LXL04_029828|LXL04_029828|OH1004|CDS

ATGATGCAGATCGGTGCGACACTTCCGGCGAACAATATTCACATGTTTCAGGGAAGACACTTTTCTGGTGGCTTTAGTTATAGGTCATCGTTGAATCCTTCTGGAAGAGAGTGTTCCACGAAGAACATGATGAAAGCCACCACCGTGTCGGCCGCCGTATCAACCCGCCAACACATCTCTAATCTTGACAAATTACTCGGTACAGAAGTACCGCAGGTGATTCTGACTGAGCCGGAACTCGCTAAGGAGGATATTTCCGA...

Protein

Download Protein FASTA

537 aa · LXL04_029828|LXL04_029828|OH1004|PROTEIN

MMQIGATLPANNIHMFQGRHFSGGFSYRSSLNPSGRECSTKNMMKATTVSAAVSTRQHISNLDKLLGTEVPQVILTEPELAKEDISDHESLDNRGKGLLGGLNLSQIWPENKAAEEMSPRHLNRLRRLLSKNGIEYSPRNSLASRWREYHGSNNWSGLLDPLDENLRREMIRYGEFIQAAYHCFHSDPATSAYEAPSPRHVALPDKSYRVTKNLYATSSVGLPKWVDKLAPGLDWMSQRSSCIGYVAVCDDQREIARMGR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029828`
TK1151 ID	TkA07G350920
OH-1004 ID	LXL04_029828
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029828

Location Chr06:101342837-101344450 (+)

Description Similar to At4g16820: Phospholipase A1-Ibeta2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g16820`	Acylhydrolase that catalyzes the hydrolysis of phosphatidylcholine at the sn-1 position.	No verified direct reference in this release
`At2g44810`	Sn-1-specific phospholipase that releases free fatty acids from phospholipids.	No verified direct reference in this release
`At1g51440`	Acylhydrolase that catalyzes the hydrolysis of phosphatidylcholine at the sn-1 position.	No verified direct reference in this release
`At1g06800`	Acylhydrolase with a broad specificity.	DONGLE and DEFECTIVE IN ANTHER DEHISCENCE1 lipases are not essential for wound- and pathogen-induced jasmonate biosynthesis: redundant lipases contribute to jasmonate formation.2010 · DOI: 10.1104/pp.110.155093
`At2g30550`	Acylhydrolase with broad specificity.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029828 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009611 response to wounding Biological Process

GO:0009695 jasmonic acid biosynthetic process Biological Process

GO:0009901 anther dehiscence Biological Process

GO:0010152 pollen maturation Biological Process

GO:0016042 lipid catabolic process Biological Process

GO:0043068 positive regulation of programmed cell death Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004620 glycerophospholipase activity Molecular Function

GO:0004806 triacylglycerol lipase activity Molecular Function

GO:0008970 glycerophospholipid phospholipase A1 activity Molecular Function

KEGG gene cross-reference

ath:AT1G06800

ath:AT1G51440

ath:AT2G30550

ath:AT2G44810

ath:AT4G16820

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.974

Rank 1 · LXL04_029828 · OH-1004

Mitochondrion0.038

Rank 2 · LXL04_029828 · OH-1004

Cytoplasm0.030

Rank 3 · LXL04_029828 · OH-1004

Nucleus0.023

Rank 4 · LXL04_029828 · OH-1004

Peroxisome0.020

Rank 5 · LXL04_029828 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01764.32Lipase_3264-411 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029828	`PF01764.32`	Lipase_3	264	411	6.5e-34	117.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23522`	Arabidopsis thaliana	Phospholipase A1-Ibeta2, chloroplastic	59.600%	Swiss-Prot	strong database homology
`Q948R1`	Arabidopsis thaliana	Phospholipase A(1) DAD1, chloroplastic	51.309%	Swiss-Prot	moderate database homology
`Q9C8J6`	Arabidopsis thaliana	Phospholipase A1-Igamma3, chloroplastic	44.628%	Swiss-Prot	moderate database homology
`Q941F1`	Arabidopsis thaliana	Phospholipase A1-Igamma1, chloroplastic	40.263%	Swiss-Prot	moderate database homology
`Q3EBR6`	Arabidopsis thaliana	Phospholipase A1-Igamma2, chloroplastic	39.474%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card