LXL04_029813 | RubberDandelionOmics

Gene overview

LXL04_029813

Reference: OH-1004 Chr: Chr06 Coordinates: 100867022-100867408 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

387 bp · LXL04_029813|LXL04_029813|OH1004|cDNA

ATGCAATTCGACGAAGCAGACACCTTATGTAAAAGAACCCTAGAAATCCACAGAGTCCACAGTCCACCAGCATCCCTCGAAGAAGCAGCAGACAGACGTCTAATGGCGCTCATATGCGAAGTAAAAGGAGACTACGAATCAGCTCTAGAACACCTCGTACTCGCCAGCATGGCAATGATCGCAAACGGCCAAGACAACGAAGTCGCAGCAATCGATCTCAGCATCGGCAACATCTACCTCTCCCTCTCCCGTTTCGACGA...

CDS

Download CDS FASTA

387 bp · LXL04_029813|LXL04_029813|OH1004|CDS

ATGCAATTCGACGAAGCAGACACCTTATGTAAAAGAACCCTAGAAATCCACAGAGTCCACAGTCCACCAGCATCCCTCGAAGAAGCAGCAGACAGACGTCTAATGGCGCTCATATGCGAAGTAAAAGGAGACTACGAATCAGCTCTAGAACACCTCGTACTCGCCAGCATGGCAATGATCGCAAACGGCCAAGACAACGAAGTCGCAGCAATCGATCTCAGCATCGGCAACATCTACCTCTCCCTCTCCCGTTTCGACGA...

Protein

Download Protein FASTA

128 aa · LXL04_029813|LXL04_029813|OH1004|PROTEIN

MQFDEADTLCKRTLEIHRVHSPPASLEEAADRRLMALICEVKGDYESALEHLVLASMAMIANGQDNEVAAIDLSIGNIYLSLSRFDEAVFSYQKSLTVFKASKSDNHPSAPQPLSGEQVFSIRNNLEK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029813`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029813

Location Chr06:100867022-100867408 (-)

Description Similar to KLCR1: Protein KINESIN LIGHT CHAIN-RELATED 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g10840`	Protein KINESIN LIGHT CHAIN-RELATED 1.	No verified direct reference in this release
`At1g27500`	Protein KINESIN LIGHT CHAIN-RELATED 3.	No verified direct reference in this release
`At3g27960`	Protein KINESIN LIGHT CHAIN-RELATED 2.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029813 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009860 pollen tube growth Biological Process

GO:0031347 regulation of defense response Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005874 microtubule Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G27500

ath:AT3G27960

ath:AT4G10840

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.565

Rank 1 · LXL04_029813 · OH-1004

Nucleus0.305

Rank 2 · LXL04_029813 · OH-1004

Cell membrane0.100

Rank 3 · LXL04_029813 · OH-1004

Mitochondrion0.077

Rank 4 · LXL04_029813 · OH-1004

Golgi apparatus0.075

Rank 5 · LXL04_029813 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00515.35TPR_175-98 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029813	`PF00515.35`	TPR_1	75	98	8.4e-09	35.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O81629`	Arabidopsis thaliana	Protein KINESIN LIGHT CHAIN-RELATED 1	79.817%	Swiss-Prot	strong database homology
`F4HSX9`	Arabidopsis thaliana	Protein KINESIN LIGHT CHAIN-RELATED 3	65.138%	Swiss-Prot	strong database homology
`Q9LII8`	Arabidopsis thaliana	Protein KINESIN LIGHT CHAIN-RELATED 2	58.559%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card