LXL04_029785 | RubberDandelionOmics

Gene overview

LXL04_029785

Reference: OH-1004 Chr: Chr06 Coordinates: 100275357-100276039 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

327 bp · LXL04_029785|LXL04_029785|OH1004|cDNA

ATGGCGACGGGGAGCGGCGATTCGGCGGCGGTGAAGATAGTATGGAACGAGAGACAGAAAAGATTTGAAACGGAGGACAAAAAAGCATACCTGCAGTACGAGTTGAGAAACGGTGGAAAATTGATGGACATAGTTCACACCTTCGTTCCGTCAAGCAAGAGAGGCTTAGGTTTAGCTTCACATCTTGCTGTTGCCGCCTTCAATCATGCTCAATCCAATTCCTTATCCGTTATTCCAACCTGCTCTTACATCTCCGAAAC...

CDS

Download CDS FASTA

327 bp · LXL04_029785|LXL04_029785|OH1004|CDS

ATGGCGACGGGGAGCGGCGATTCGGCGGCGGTGAAGATAGTATGGAACGAGAGACAGAAAAGATTTGAAACGGAGGACAAAAAAGCATACCTGCAGTACGAGTTGAGAAACGGTGGAAAATTGATGGACATAGTTCACACCTTCGTTCCGTCAAGCAAGAGAGGCTTAGGTTTAGCTTCACATCTTGCTGTTGCCGCCTTCAATCATGCTCAATCCAATTCCTTATCCGTTATTCCAACCTGCTCTTACATCTCCGAAAC...

Protein

Download Protein FASTA

108 aa · LXL04_029785|LXL04_029785|OH1004|PROTEIN

MATGSGDSAAVKIVWNERQKRFETEDKKAYLQYELRNGGKLMDIVHTFVPSSKRGLGLASHLAVAAFNHAQSNSLSVIPTCSYISETFVPRNPSWKPVLYSEDLKSSI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029785`
TK1151 ID	TkAUNG064880
OH-1004 ID	LXL04_029785
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029785

Location Chr06:100275357-100276039 (+)

Description Similar to At1g77540: Acetyltransferase At1g77540

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g77540`	Possesses in vitro histone acetyltransferase activity with histones H3 and H4.	Structure of Arabidopsis thaliana At1g77540 protein, a minimal acetyltransferase from the COG2388 family.2006 · DOI: 10.1021/bi0612059

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029785 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0004402 histone acetyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G77540

bta:783664

hsa:256302

xla:432144

xtr:493452

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.465

Rank 1 · LXL04_029785 · OH-1004

Nucleus0.346

Rank 2 · LXL04_029785 · OH-1004

Mitochondrion0.260

Rank 3 · LXL04_029785 · OH-1004

Peroxisome0.079

Rank 4 · LXL04_029785 · OH-1004

Cell membrane0.078

Rank 5 · LXL04_029785 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14542.13Acetyltransf_CG22-96 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029785	`PF14542.13`	Acetyltransf_CG	22	96	3.4e-20	72.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9CAQ2`	Arabidopsis thaliana	Acetyltransferase At1g77540	69.072%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card