Gene Card
Gene overview
cDNA / CDS / Protein Sequences
3867 bp · LXL04_029751|LXL04_029751|OH1004|cDNA
ATGGACGACACTGATGAAGATTTCTTTGATAAATTGGTCGATGACGTTGATGATCAATTCAAGGTCACTTCATCATCGTCTGCCAAACCAACCGTGGATGATCCCACCGAGGCTAAAGCTGATTCAAGCATCAACAATGGCAAAAACGCACTCAAAGAATTAGAGAAAGTAGGTACAGAAGATATCAAAGCTCCTTCCACGATTAGTTCAGGTCTCGTAGATAAATCAACCACCAATCGAGTGGACCCTAATCAGTCATT...
3867 bp · LXL04_029751|LXL04_029751|OH1004|CDS
ATGGACGACACTGATGAAGATTTCTTTGATAAATTGGTCGATGACGTTGATGATCAATTCAAGGTCACTTCATCATCGTCTGCCAAACCAACCGTGGATGATCCCACCGAGGCTAAAGCTGATTCAAGCATCAACAATGGCAAAAACGCACTCAAAGAATTAGAGAAAGTAGGTACAGAAGATATCAAAGCTCCTTCCACGATTAGTTCAGGTCTCGTAGATAAATCAACCACCAATCGAGTGGACCCTAATCAGTCATT...
Protein
Download Protein FASTA1288 aa · LXL04_029751|LXL04_029751|OH1004|PROTEIN
MDDTDEDFFDKLVDDVDDQFKVTSSSSAKPTVDDPTEAKADSSINNGKNALKELEKVGTEDIKAPSTISSGLVDKSTTNRVDPNQSLVSSSSFASHTVNEEPNHEKQMEETWYHESGGASGAKEVQWSSFTTDPLHNTGNSFGSYSDFFTEFGDNSVHQSKTENYLSNQVNSNNDNSNQYQEGQSYTNTTSGRQSSEGQDLNSSQYWENLYPGWKYDNNTGQWYQVDESYDPTTTTNTQAADTLSSASDWTATSVNTEVA...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_029751 |
|---|---|
| TK1151 ID | TkA07G343460 |
| OH-1004 ID | LXL04_029751 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 98.400 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_029751 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr06:99088006-99092738 (-) | |||||||||
| Description | Similar to SEC16B: Protein transport protein SEC16B homolog | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0003400 regulation of COPII vesicle coating Biological Process GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process GO:0006893 Golgi to plasma membrane transport Biological Process GO:0007029 endoplasmic reticulum organization Biological Process GO:0007030 Golgi organization Biological Process GO:0007031 peroxisome organization Biological Process GO:0010628 positive regulation of gene expression Biological Process GO:0015031 protein transport Biological Process GO:0016559 peroxisome fission Biological Process GO:0032527 protein exit from endoplasmic reticulum Biological Process GO:0034976 response to endoplasmic reticulum stress Biological Process GO:0050821 protein stabilization Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT5G47480 ath:AT5G47490 hsa:89866 mmu:227648 ocu:100008637 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF12932.13Sec16447-558 aaPF12931.14TPR_Sec16617-886 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_029751 | PF12932.13 | Sec16 | 447 | 558 | 9.9e-15 | 55.8 |
| LXL04_029751 | PF12931.14 | TPR_Sec16 | 617 | 886 | 4.1e-53 | 181.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.