Gene Card
Gene overview
cDNA / CDS / Protein Sequences
744 bp · LXL04_029749|LXL04_029749|OH1004|cDNA
ATGGCCGAACATTCAGATGATTTAGACCAACTTCTAGATAGCGCTTTGGATGATTTCCAGACCCTCAATCTtgcatcttcttcttctcagaGTAAGGATGGTGAAGGGAACAAAGGAGAGGCATCTTCATTACCGAGTGGTGTTCAAGGATTAGGTATGGGTTTGCCTGATTTGAGAAGCAAGAACAAAGGAAAGCAAAAAGCGACACCAAAAGTCTCAAATGCTTCCGAGACTCTCAATAAGTTAAGAGAGCAAACTAG...
744 bp · LXL04_029749|LXL04_029749|OH1004|CDS
ATGGCCGAACATTCAGATGATTTAGACCAACTTCTAGATAGCGCTTTGGATGATTTCCAGACCCTCAATCTTGCATCTTCTTCTTCTCAGAGTAAGGATGGTGAAGGGAACAAAGGAGAGGCATCTTCATTACCGAGTGGTGTTCAAGGATTAGGTATGGGTTTGCCTGATTTGAGAAGCAAGAACAAAGGAAAGCAAAAAGCGACACCAAAAGTCTCAAATGCTTCCGAGACTCTCAATAAGTTAAGAGAGCAAACTAG...
Protein
Download Protein FASTA247 aa · LXL04_029749|LXL04_029749|OH1004|PROTEIN
MAEHSDDLDQLLDSALDDFQTLNLASSSSQSKDGEGNKGEASSLPSGVQGLGMGLPDLRSKNKGKQKATPKVSNASETLNKLREQTRETVKGLESIAGLKPGPIDGLGDDKMMEDLVKQFEELAKGQDMESIVETMMQQLLSKEVLHEPMKEIGERYPKWLQENKSKLSQEEYDRFFHQHELIRDLNVVYESEPDNFNKIIELMQKMQECGQPPNDIVKELAPDFDISALGQLTGEMADSQQNCCIM
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_029749 |
|---|---|
| TK1151 ID | TkA07G343440 |
| OH-1004 ID | LXL04_029749 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.600 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_029749 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr06:99077518-99078855 (-) | |||||||||
| Description | Similar to PEX19-1: Peroxisome biogenesis protein 19-1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006457 protein folding Biological Process GO:0006625 protein targeting to peroxisome Biological Process GO:0007031 peroxisome organization Biological Process GO:0016557 peroxisome membrane biogenesis Biological Process GO:0016559 peroxisome fission Biological Process GO:0045046 protein import into peroxisome membrane Biological Process GO:0050821 protein stabilization Biological Process GO:0072663 establishment of protein localization to peroxisome Biological Process GO:1900131 negative regulation of lipid binding Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005777 peroxisome Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT3G03490 ath:AT5G17550 hsa:5824 pon:100173241 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF04614.18Pex1943-247 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_029749 | PF04614.18 | Pex19 | 43 | 247 | 3e-36 | 126.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.