LXL04_029748 | RubberDandelionOmics

Gene overview

LXL04_029748

Reference: OH-1004 Chr: Chr06 Coordinates: 99074884-99076524 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

530 bp · LXL04_029748|LXL04_029748|OH1004|cDNA

GTCGACAAAAAAAATGGAATTTCCAGTCAAGATAATCTCTTTATCATTTCTCACGATATAAGATATAAGTTCCAAAAAATCCATCGTGTCCTGCTTCTCTGTTTCCCGATCGCCACTAGTTTTATCTTATTTCTCAAATGGCGACCCGAACTCAAATGCCTTCCAACAGCTCAGGACTTATTGCTATGATTGCTGATGAGGACACAATAACCGGATTTTTACTTGCTGGAGTAGGAAACGTTGACATAAGGAGGAAGACA...

CDS

Download CDS FASTA

393 bp · LXL04_029748|LXL04_029748|OH1004|CDS

ATGGCGACCCGAACTCAAATGCCTTCCAACAGCTCAGGACTTATTGCTATGATTGCTGATGAGGACACAATAACCGGATTTTTACTTGCTGGAGTAGGAAACGTTGACATAAGGAGGAAGACAAATTACCTGATTGTGGATTCAAAGACAACAGTGAAACAAATTGAGGATGCTTTTAAGGACTTTACCACAAGAGAGGACGTAGCAATAGTCTTGATCAGTCAATATGTTGCAAATATGGTACGGTTTGTAGTGGATAG...

Protein

Download Protein FASTA

130 aa · LXL04_029748|LXL04_029748|OH1004|PROTEIN

MATRTQMPSNSSGLIAMIADEDTITGFLLAGVGNVDIRRKTNYLIVDSKTTVKQIEDAFKDFTTREDVAIVLISQYVANMVRFVVDSYNNPVPAILEIPSKDHPYDPQHDSVLSRVKYLFNTESVAGDRR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029748`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029748

Location Chr06:99074884-99076524 (-)

Description Similar to VHA-F: V-type proton ATPase subunit F

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g02620`	Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029748 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007042 lysosomal lumen acidification Biological Process

GO:0000221 vacuolar proton-transporting V-type ATPase, V1 domain Cellular Component

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0016471 vacuolar proton-transporting V-type ATPase complex Cellular Component

GO:0030665 clathrin-coated vesicle membrane Cellular Component

KEGG gene cross-reference

ath:AT4G02620

cel:CELE_ZK970.4

ddi:DDB_G0271882

mmu:66144

rno:116664

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.657

Rank 1 · LXL04_029748 · OH-1004

Nucleus0.342

Rank 2 · LXL04_029748 · OH-1004

Cell membrane0.076

Rank 3 · LXL04_029748 · OH-1004

Lysosome / Vacuole0.059

Rank 4 · LXL04_029748 · OH-1004

Mitochondrion0.056

Rank 5 · LXL04_029748 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01990.23ATP-synt_F15-116 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029748	`PF01990.23`	ATP-synt_F	15	116	1.4e-28	99.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZQX4`	Arabidopsis thaliana	V-type proton ATPase subunit F	78.571%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card