LXL04_029720 | RubberDandelionOmics

Gene overview

LXL04_029720

Reference: OH-1004 Chr: Chr06 Coordinates: 98357184-98359578 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1788 bp · LXL04_029720|LXL04_029720|OH1004|cDNA

ATGGCCGACGAAGCCAAGGCCAAAGGTAACGCCGCGTTCTCTGCCGGAAACTACACCGAAGCTATCCGTCACTTCACTGACGCCATTAACCTCGCCCCTACCAACCACGTTCTTTACTCCAACCGATCTGCCGCTTACGCTTCCCTGAATCAATATTCCGAAGCCCTAACAGATGCTCAAAAGACTGTCGATCTGAAACCCGACTGGTCCAAATGCTACTCACGACTCGGCGCGGCTCATCATGGCTTGCATCAATATGA...

CDS

Download CDS FASTA

1788 bp · LXL04_029720|LXL04_029720|OH1004|CDS

ATGGCCGACGAAGCCAAGGCCAAAGGTAACGCCGCGTTCTCTGCCGGAAACTACACCGAAGCTATCCGTCACTTCACTGACGCCATTAACCTCGCCCCTACCAACCACGTTCTTTACTCCAACCGATCTGCCGCTTACGCTTCCCTGAATCAATATTCCGAAGCCCTAACAGATGCTCAAAAGACTGTCGATCTGAAACCCGACTGGTCCAAATGCTACTCACGACTCGGCGCGGCTCATCATGGCTTGCATCAATATGA...

Protein

Download Protein FASTA

595 aa · LXL04_029720|LXL04_029720|OH1004|PROTEIN

MADEAKAKGNAAFSAGNYTEAIRHFTDAINLAPTNHVLYSNRSAAYASLNQYSEALTDAQKTVDLKPDWSKCYSRLGAAHHGLHQYDDAVLAYKKGLEVDPNNETLKSGLASAQSDQAAASASSRSRAPPNNLFGDAFGPDMWAKLTADPATRLYMQQPDFVNMMKDLQKNPSNLNLYLKDQRVMQALSVLLNVKMQSHMPGDDMEMPDSPPKERKRPADETETVKEKKREPEPEPEPMEVNEEEKETKEKKAQAQKEKE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029720`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029720

Location Chr06:98357184-98359578 (+)

Description Similar to HOP2: Hsp70-Hsp90 organizing protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g62740`	Mediates the association of the molecular chaperones HSP70 and HSP90.	No verified direct reference in this release
`At4g12400`	Mediates the association of the molecular chaperones HSP70 and HSP90.	No verified direct reference in this release
`At1g12270`	Mediates the association of the molecular chaperones HSP70 and HSP90.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029720 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006986 response to unfolded protein Biological Process

GO:0009408 response to heat Biological Process

GO:0009611 response to wounding Biological Process

GO:0010286 heat acclimation Biological Process

GO:0034605 cellular response to heat Biological Process

GO:0046686 response to cadmium ion Biological Process

GO:0051131 chaperone-mediated protein complex assembly Biological Process

GO:0070417 cellular response to cold Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0051879 Hsp90 protein binding Molecular Function

KEGG gene cross-reference

ath:AT1G62740

ath:AT4G12400

gmx:547932

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.657

Rank 1 · LXL04_029720 · OH-1004

Nucleus0.403

Rank 2 · LXL04_029720 · OH-1004

Mitochondrion0.132

Rank 3 · LXL04_029720 · OH-1004

Cell membrane0.074

Rank 4 · LXL04_029720 · OH-1004

Endoplasmic reticulum0.071

Rank 5 · LXL04_029720 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25575.1TPR_BSK1_C4-71 aa

PF07719.24TPR_27-35 aa

PF00515.35TPR_18-35 aa

PF13414.13TPR_119-47 aa

PF14559.13TPR_1912-56 aa

PF00515.35TPR_171-103 aa

PF07719.24TPR_271-103 aa

PF17830.7STI1-HOP_DP140-192 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029720	`PF25575.1`	TPR_BSK1_C	4	71	3.1e-24	85.9
LXL04_029720	`PF07719.24`	TPR_2	7	35	1.2e-44	147.4
LXL04_029720	`PF00515.35`	TPR_1	8	35	1.2e-59	196.5
LXL04_029720	`PF13414.13`	TPR_11	9	47	4.7e-38	129.3
LXL04_029720	`PF14559.13`	TPR_19	12	56	1.5e-22	80.4
LXL04_029720	`PF00515.35`	TPR_1	71	103	1.2e-59	196.5
LXL04_029720	`PF07719.24`	TPR_2	71	103	1.2e-44	147.4
LXL04_029720	`PF17830.7`	STI1-HOP_DP	140	192	5.5e-26	90.9
LXL04_029720	`PF25575.1`	TPR_BSK1_C	249	317	3.1e-24	85.9
LXL04_029720	`PF00515.35`	TPR_1	262	285	1.2e-59	196.5
LXL04_029720	`PF13414.13`	TPR_11	262	303	4.7e-38	129.3
LXL04_029720	`PF25068.3`	ARM_TT21_4th	262	421	4.1e-07	31.1
LXL04_029720	`PF13431.13`	TPR_17	278	309	7.1e-26	89.0
LXL04_029720	`PF00515.35`	TPR_1	292	317	1.2e-59	196.5
LXL04_029720	`PF13424.13`	TPR_12	292	361	4.7e-25	88.3
LXL04_029720	`PF25575.1`	TPR_BSK1_C	373	462	3.1e-24	85.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q5XEP2`	Arabidopsis thaliana	Hsp70-Hsp90 organizing protein 2	71.429%	Swiss-Prot	strong database homology
`Q9STH1`	Arabidopsis thaliana	Hsp70-Hsp90 organizing protein 3	70.524%	Swiss-Prot	strong database homology
`Q9LNB6`	Arabidopsis thaliana	Hsp70-Hsp90 organizing protein 1	70.090%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card