LXL04_029704 | RubberDandelionOmics

Gene overview

LXL04_029704

Reference: OH-1004 Chr: Chr06 Coordinates: 97643677-97645981 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1428 bp · LXL04_029704|LXL04_029704|OH1004|cDNA

ATGATGCAGATGGATCGGAGACAGTGCTCAGATGAGTTTGAAAAACTTCTCATCCGAATGAACACTCCAAGGGTAATGACCGACAACGCCAGCTGTCTAAACGCAACTCGCGTCATGGTAATCTTCAAAACAAATCTACCATACTCTCCCATTAAAACATATCTTTGCTACCAATTTTCAACTGAAATCAATCCAAAAAAAAATATCTCCAAATTTCAGATCGACAGTGCAAGAAAAGATGAAATTTTGCTGGAGGCGGT...

CDS

Download CDS FASTA

1428 bp · LXL04_029704|LXL04_029704|OH1004|CDS

ATGATGCAGATGGATCGGAGACAGTGCTCAGATGAGTTTGAAAAACTTCTCATCCGAATGAACACTCCAAGGGTAATGACCGACAACGCCAGCTGTCTAAACGCAACTCGCGTCATGGTAATCTTCAAAACAAATCTACCATACTCTCCCATTAAAACATATCTTTGCTACCAATTTTCAACTGAAATCAATCCAAAAAAAAATATCTCCAAATTTCAGATCGACAGTGCAAGAAAAGATGAAATTTTGCTGGAGGCGGT...

Protein

Download Protein FASTA

475 aa · LXL04_029704|LXL04_029704|OH1004|PROTEIN

MMQMDRRQCSDEFEKLLIRMNTPRVMTDNASCLNATRVMVIFKTNLPYSPIKTYLCYQFSTEINPKKNISKFQIDSARKDEILLEAVQVLTDLNLSIKKGYVSSDGRWNMDVFHVTDLDGNKLTDDNIINCIEQSLETIHNKRSNSIDGMTALELTGTDRIGLLSEVFAVLSDLKCDVVESKVWTHNGRIASLIYLKDTESGFQIEDSNKIDKIKARLRNVLKGDNDIRSAKTSVSIAVTHMERRLHQMMFADRDYARKM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029704`
TK1151 ID	TkA07G337730
OH-1004 ID	LXL04_029704
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	92.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029704

Location Chr06:97643677-97645981 (+)

Description Similar to ACR8: ACT domain-containing protein ACR8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g12420`	May bind amino acids.	Molecular characterization of a novel gene family encoding ACT domain repeat proteins in Arabidopsis.2002 · DOI: 10.1104/pp.007484
`At4g22780`	May bind amino acids.	No verified direct reference in this release
`At1g69040`	May bind amino acids.	No verified direct reference in this release
`At3g01990`	May bind amino acids.	No verified direct reference in this release
`At1g76990`	May bind amino acids.	Molecular characterization of a novel gene family encoding ACT domain repeat proteins in Arabidopsis.2002 · DOI: 10.1104/pp.007484

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029704 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006521 regulation of amino acid metabolic process Biological Process

GO:0009735 response to cytokinin Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005829 cytosol Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016597 amino acid binding Molecular Function

KEGG gene cross-reference

ath:AT1G12420

ath:AT1G69040

ath:AT3G01990

ath:AT4G22780

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.483

Rank 1 · LXL04_029704 · OH-1004

Nucleus0.380

Rank 2 · LXL04_029704 · OH-1004

Cell membrane0.132

Rank 3 · LXL04_029704 · OH-1004

Lysosome / Vacuole0.065

Rank 4 · LXL04_029704 · OH-1004

Endoplasmic reticulum0.054

Rank 5 · LXL04_029704 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26956.1ACT_ACR_D172-140 aa

PF01842.32ACT152-201 aa

PF13740.13ACT_6154-191 aa

PF24931.2ACT_ACR9_3rd270-351 aa

PF01842.32ACT282-339 aa

PF01842.32ACT363-423 aa

PF26956.1ACT_ACR_D1366-426 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029704	`PF26956.1`	ACT_ACR_D1	72	140	1.6e-44	150.4
LXL04_029704	`PF01842.32`	ACT	152	201	7.1e-28	96.7
LXL04_029704	`PF13740.13`	ACT_6	154	191	4e-08	33.7
LXL04_029704	`PF24931.2`	ACT_ACR9_3rd	270	351	3.6e-17	62.9
LXL04_029704	`PF01842.32`	ACT	282	339	7.1e-28	96.7
LXL04_029704	`PF01842.32`	ACT	363	423	7.1e-28	96.7
LXL04_029704	`PF26956.1`	ACT_ACR_D1	366	426	1.6e-44	150.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LNA5`	Arabidopsis thaliana	ACT domain-containing protein ACR8	58.898%	Swiss-Prot	strong database homology
`Q8LJW1`	Arabidopsis thaliana	ACT domain-containing protein ACR7	55.579%	Swiss-Prot	strong database homology
`Q8LJW3`	Arabidopsis thaliana	ACT domain-containing protein ACR4	46.347%	Swiss-Prot	moderate database homology
`Q9SGA0`	Arabidopsis thaliana	ACT domain-containing protein ACR6	48.357%	Swiss-Prot	moderate database homology
`O49285`	Arabidopsis thaliana	ACT domain-containing protein ACR3	44.000%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card