LXL04_029642 | RubberDandelionOmics

Gene overview

LXL04_029642

Reference: OH-1004 Chr: Chr06 Coordinates: 96140440-96145113 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2034 bp · LXL04_029642|LXL04_029642|OH1004|cDNA

ATGGCTCTGTCAACCATTAGCCACGGCCACGCTCCGGCGGATACAAACGGTTGTGATGATTCACCGATTTACCAACTTCTCCTCGACCGTTGCCGGAGCTTAGAGACAAGTTACGCCAACCTACAAGAGCAATTCCAGATGCTCGAGCAAGGACAGGCATCATCTTATAATCAAGGAAACTTAGTTCAGCAAGAGGTGATTCCTACACGACCCGGTATGTCGCCCTTTTCAGGTTGGAGTAATGTTCCGGATGCTTTACC...

CDS

Download CDS FASTA

2034 bp · LXL04_029642|LXL04_029642|OH1004|CDS

ATGGCTCTGTCAACCATTAGCCACGGCCACGCTCCGGCGGATACAAACGGTTGTGATGATTCACCGATTTACCAACTTCTCCTCGACCGTTGCCGGAGCTTAGAGACAAGTTACGCCAACCTACAAGAGCAATTCCAGATGCTCGAGCAAGGACAGGCATCATCTTATAATCAAGGAAACTTAGTTCAGCAAGAGGTGATTCCTACACGACCCGGTATGTCGCCCTTTTCAGGTTGGAGTAATGTTCCGGATGCTTTACC...

Protein

Download Protein FASTA

677 aa · LXL04_029642|LXL04_029642|OH1004|PROTEIN

MALSTISHGHAPADTNGCDDSPIYQLLLDRCRSLETSYANLQEQFQMLEQGQASSYNQGNLVQQEVIPTRPGMSPFSGWSNVPDALPVGFSYKRALDQLGHAVYVSKAITRTIIYWNRSAEKLFGYEDYEALGQTVTDLLIYDEFQASSEKILVRVRSGQSWAGQFPFRKRSGVTFMALVNKSPLYEDGELVGIVTVASDATIFNKIKSENPKSYQEDPTNGQNKTKGINFKKLQWHPPQQLSSFVSNLNQTSKDILRKG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029642`
TK1151 ID	TkA07G332660
OH-1004 ID	LXL04_029642
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029642

Location Chr06:96140440-96145113 (-)

Description Similar to EDR1: Serine/threonine-protein kinase EDR1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g73660`	Acts as a negative regulator of salt tolerance.	The genetic locus At1g73660 encodes a putative MAPKKK and negatively regulates salt tolerance in Arabidopsis.2008 · DOI: 10.1007/s11103-008-9306-8 SIS8, a putative mitogen-activated protein kinase kinase kinase, regulates sugar-resistant seedling development in Arabidopsis.2014 · DOI: 10.1111/tpj.12404
`At1g08720`	MAPKKK serine/threonine-protein kinase involved in the regulation of a MAP kinase cascade (probably including MPK3 and MPK6) that negatively regulates salicylic acid- (SA-) dependent defense responses, abscisic acid (ABA) signaling, and ethylene-induced senescence.	Negative regulation of defense responses in plants by a conserved MAPKK kinase.2001 · DOI: 10.1073/pnas.98.1.373 Overexpression of a kinase-deficient form of the EDR1 gene enhances powdery mildew resistance and ethylene-induced senescence in Arabidopsis.2002 · DOI: 10.1046/j.1365-313x.2002.01482.x Regulation of plant disease resistance, stress responses, cell death, and ethylene signaling in Arabidopsis by the EDR1 protein kinase.2005 · DOI: 10.1104/pp.105.060400 Costs and benefits of priming for defense in Arabidopsis.2006 · DOI: 10.1073/pnas.0510213103 Powdery mildew resistance conferred by loss of the ENHANCED DISEASE RESISTANCE1 protein kinase is suppressed by a missense mutation in KEEP ON GOING, a regulator of abscisic acid signaling.2008 · DOI: 10.1104/pp.108.127605 Mitogen-activated protein kinases 3 and 6 are required for full priming of stress responses in Arabidopsis thaliana.2009 · DOI: 10.1105/tpc.108.062158 The KEEP ON GOING protein of Arabidopsis recruits the ENHANCED DISEASE RESISTANCE1 protein to trans-Golgi network/early endosome vesicles.2011 · DOI: 10.1104/pp.110.171785 Arabidopsis ENHANCED DISEASE RESISTANCE 1 is required for pathogen-induced expression of plant defensins in nonhost resistance, and acts through interference of MYC2-mediated repressor function.2011 · DOI: 10.1111/j.1365-313x.2011.04651.x Negative regulation of defence signalling pathways by the EDR1 protein kinase.2011 · DOI: 10.1111/j.1364-3703.2011.00708.x An Arabidopsis mutant with enhanced resistance to powdery mildew.1998 · DOI: 10.1105/tpc.10.6.947
`At5g03730`	Acts as a negative regulator in the ethylene response pathway.	CTR1 phosphorylates the central regulator EIN2 to control ethylene hormone signaling from the ER membrane to the nucleus in Arabidopsis.2012 · DOI: 10.1073/pnas.1214848109 Unsaturation of very-long-chain ceramides protects plant from hypoxia-induced damages by modulating ethylene signaling in Arabidopsis.2015 · DOI: 10.1371/journal.pgen.1005143 CTR1, a negative regulator of the ethylene response pathway in Arabidopsis, encodes a member of the raf family of protein kinases.1993 · DOI: 10.1016/0092-8674(93)90119-b

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029642 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000165 MAPK cascade Biological Process

GO:0001666 response to hypoxia Biological Process

GO:0001845 phagolysosome assembly Biological Process

GO:0002229 defense response to oomycetes Biological Process

GO:0006909 phagocytosis Biological Process

GO:0007165 signal transduction Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009620 response to fungus Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009686 gibberellin biosynthetic process Biological Process

GO:0009723 response to ethylene Biological Process

KEGG gene cross-reference

ath:AT1G08720

ath:AT1G73660

ath:AT5G03730

ddi:DDB_G0281557

ddi:DDB_G0281899

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.488

Rank 1 · LXL04_029642 · OH-1004

Cell membrane0.364

Rank 2 · LXL04_029642 · OH-1004

Nucleus0.194

Rank 3 · LXL04_029642 · OH-1004

Golgi apparatus0.113

Rank 4 · LXL04_029642 · OH-1004

Endoplasmic reticulum0.067

Rank 5 · LXL04_029642 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00989.32PAS92-200 aa

PF13426.14PAS_9112-202 aa

PF07714.24PK_Tyr_Ser-Thr418-669 aa

PF00069.32Pkinase420-667 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029642	`PF00989.32`	PAS	92	200	3.7e-11	43.8
LXL04_029642	`PF13426.14`	PAS_9	112	202	2.3e-10	41.4
LXL04_029642	`PF07714.24`	PK_Tyr_Ser-Thr	418	669	2.8e-66	224.2
LXL04_029642	`PF00069.32`	Pkinase	420	667	1.2e-54	186.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C9U5`	Arabidopsis thaliana	Probable serine/threonine-protein kinase SIS8	55.882%	Swiss-Prot	weak database homology
`Q9FPR3`	Arabidopsis thaliana	Serine/threonine-protein kinase EDR1	55.435%	Swiss-Prot	weak database homology
`Q05609`	Arabidopsis thaliana	Serine/threonine-protein kinase CTR1	58.519%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card