LXL04_029623 | RubberDandelionOmics

Gene overview

LXL04_029623

Reference: OH-1004 Chr: Chr06 Coordinates: 95658257-95660501 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1734 bp · LXL04_029623|LXL04_029623|OH1004|cDNA

ATGGAGGTGCCAAAATCGACTCCCTGGAGCAACATTGTAAAGCAAACCCCTCCACCGCAAAACCCTAATAATCACCATCATGATCAGTCACAGTCGGTCGCGGCAGCTTTTGTTGGCAGCTGTAAGTCTACCAAAGGTATTGCCGTCGCCGTGGTGGATGCCAACGCCATCATACAAGGAGGAGAACAGCTTCACCATGCCGCCGACAAGTTTGTCTCCGTCTCCGATGTCATCCAAGAAGTACGTGACCCTACATCTAG...

CDS

Download CDS FASTA

1734 bp · LXL04_029623|LXL04_029623|OH1004|CDS

ATGGAGGTGCCAAAATCGACTCCCTGGAGCAACATTGTAAAGCAAACCCCTCCACCGCAAAACCCTAATAATCACCATCATGATCAGTCACAGTCGGTCGCGGCAGCTTTTGTTGGCAGCTGTAAGTCTACCAAAGGTATTGCCGTCGCCGTGGTGGATGCCAACGCCATCATACAAGGAGGAGAACAGCTTCACCATGCCGCCGACAAGTTTGTCTCCGTCTCCGATGTCATCCAAGAAGTACGTGACCCTACATCTAG...

Protein

Download Protein FASTA

577 aa · LXL04_029623|LXL04_029623|OH1004|PROTEIN

MEVPKSTPWSNIVKQTPPPQNPNNHHHDQSQSVAAAFVGSCKSTKGIAVAVVDANAIIQGGEQLHHAADKFVSVSDVIQEVRDPTSRHRLNFLPFTVDTMEPSPESLKKVISFAKATGDLQTLSDVDLKLIALTHTLESQIHGTSHLRDTPPPIRTVNVKRLPEKELPGWGSNVPNLAEWELIEHADGDGTGPDSRILPLKDLNMNVLPGDKDQSNEDSASANGSEPQYNNNEDGGFNRPQKYFPKKKEIVIEGKKNVAS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029623`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029623

Location Chr06:95658257-95660501 (+)

Description Similar to NOB1: RNA-binding NOB1-like protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g41190`	Essential protein required during embryogenesis and pollen development.	40S ribosome biogenesis co-factors are essential for gametophyte and embryo development.2013 · DOI: 10.1371/journal.pone.0054084

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029623 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006364 rRNA processing Biological Process

GO:0009553 embryo sac development Biological Process

GO:0009555 pollen development Biological Process

GO:0030490 maturation of SSU-rRNA Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0030688 preribosome, small subunit precursor Cellular Component

GO:0004521 RNA endonuclease activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0016787 hydrolase activity Molecular Function

KEGG gene cross-reference

ath:AT5G41190

pon:100174418

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.657

Rank 1 · LXL04_029623 · OH-1004

Cytoplasm0.279

Rank 2 · LXL04_029623 · OH-1004

Endoplasmic reticulum0.043

Rank 3 · LXL04_029623 · OH-1004

Golgi apparatus0.041

Rank 4 · LXL04_029623 · OH-1004

Plastid0.040

Rank 5 · LXL04_029623 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17146.11PIN_651-137 aa

PF08772.17Zn_ribbon_NOB1429-499 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029623	`PF17146.11`	PIN_6	51	137	2.9e-26	92.4
LXL04_029623	`PF08772.17`	Zn_ribbon_NOB1	429	499	4.2e-23	82.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FLL1`	Arabidopsis thaliana	RNA-binding NOB1-like protein	57.661%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card