LXL04_029510 | RubberDandelionOmics

Gene overview

LXL04_029510

Reference: OH-1004 Chr: Chr06 Coordinates: 92655424-92657042 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

873 bp · LXL04_029510|LXL04_029510|OH1004|cDNA

ATGGATGTGGACAAATTCGAGCTCATAAAAGCTCAATTGCAACCGTTTTTACGGCAAGGGGAGGAGTATTTTCGGCGTGTCGAAGGGTTTGCTCGTGAGATCCCTCCAATTCAGATCTATATTGCTGTTGCAGCTGTGTTCTTGACTACCTTGTTAATCTACATAAGTAATTCCACTACTCTCTCTTGGCATCTAATCATTTCTGTTGTTAGTGATTCTCTAGTTTGTGGATTACGTGTGTTAAAGCATACAGTATCCAA...

CDS

Download CDS FASTA

873 bp · LXL04_029510|LXL04_029510|OH1004|CDS

ATGGATGTGGACAAATTCGAGCTCATAAAAGCTCAATTGCAACCGTTTTTACGGCAAGGGGAGGAGTATTTTCGGCGTGTCGAAGGGTTTGCTCGTGAGATCCCTCCAATTCAGATCTATATTGCTGTTGCAGCTGTGTTCTTGACTACCTTGTTAATCTACATAAGTAATTCCACTACTCTCTCTTGGCATCTAATCATTTCTGTTGTTAGTGATTCTCTAGTTTGTGGATTACGTGTGTTAAAGCATACAGTATCCAA...

Protein

Download Protein FASTA

290 aa · LXL04_029510|LXL04_029510|OH1004|PROTEIN

MDVDKFELIKAQLQPFLRQGEEYFRRVEGFAREIPPIQIYIAVAAVFLTTLLIYISNSTTLSWHLIISVVSDSLVCGLRVLKHTVSNTIVLSGLSGGGKTVLFYQLRDGTSHQGTVTSMEPNEGHFVLNSETSKKGKIKAVRIVDVPGHSRLRPKLDEYIPVAAGIVFVVDAVEFLPNCRAVSEYLYDILTKASVVKRKIPLLILCNKVDKVTAHTKEFIRKQLEKEIDKLRTSRKAVSDADISNEFTLGVPGEPFSFSH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029510`
TK1151 ID	TkA02G263710
OH-1004 ID	LXL04_029510
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	91.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029510

Location Chr06:92655424-92657042 (+)

Description Similar to srprb: Signal recognition particle receptor subunit beta

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g37680`	May play a role in lysosome motility.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029510 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006617 SRP-dependent cotranslational protein targeting to membrane, signal sequence recognition Biological Process

GO:0007059 chromosome segregation Biological Process

GO:0015031 protein transport Biological Process

GO:0045047 protein targeting to ER Biological Process

GO:0051301 cell division Biological Process

GO:0051607 defense response to virus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005765 lysosomal membrane Cellular Component

GO:0005785 signal recognition particle receptor complex Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005819 spindle Cellular Component

KEGG gene cross-reference

ath:AT5G37680

ddi:DDB_G0278543

hsa:58477

mmu:20818

rno:300965

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.614

Rank 1 · LXL04_029510 · OH-1004

Cytoplasm0.142

Rank 2 · LXL04_029510 · OH-1004

Nucleus0.127

Rank 3 · LXL04_029510 · OH-1004

Golgi apparatus0.087

Rank 4 · LXL04_029510 · OH-1004

Mitochondrion0.086

Rank 5 · LXL04_029510 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09439.17SRPRB86-263 aa

PF00025.28Arf86-227 aa

PF00009.34GTP_EFTU126-281 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029510	`PF09439.17`	SRPRB	86	263	3.8e-34	118.3
LXL04_029510	`PF00025.28`	Arf	86	227	4.2e-15	56.4
LXL04_029510	`PF00009.34`	GTP_EFTU	126	281	7e-08	33.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W4C8`	Arabidopsis thaliana	ADP-ribosylation factor-like protein 8c	34.810%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card