LXL04_029495 | RubberDandelionOmics

Gene overview

LXL04_029495

Reference: OH-1004 Chr: Chr06 Coordinates: 92327209-92327619 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

318 bp · LXL04_029495|LXL04_029495|OH1004|cDNA

ATGGTCGAATTGCCGGTGATGAAAAACAGGTGCCGAAAGGGCATTTGGCGGTGTACTTTGGGGAAGAAGAGGACGATGCGCGGAGAGTTTTGGCCTCTGCCTCACGTTTCTCTTGTTAAATCGGAAAATCAAAACCTAAATCGGAACAATAATTCAATCACGGAATGCAAAGCACAAGGAATTAAAGCCCTAGGATTGGTATGCCATGTTTCCAATGAACAACAAAGAAAAAATCTCATTCAACAGACAGTTCAGAAATA...

CDS

Download CDS FASTA

318 bp · LXL04_029495|LXL04_029495|OH1004|CDS

ATGGTCGAATTGCCGGTGATGAAAAACAGGTGCCGAAAGGGCATTTGGCGGTGTACTTTGGGGAAGAAGAGGACGATGCGCGGAGAGTTTTGGCCTCTGCCTCACGTTTCTCTTGTTAAATCGGAAAATCAAAACCTAAATCGGAACAATAATTCAATCACGGAATGCAAAGCACAAGGAATTAAAGCCCTAGGATTGGTATGCCATGTTTCCAATGAACAACAAAGAAAAAATCTCATTCAACAGACAGTTCAGAAATA...

Protein

Download Protein FASTA

105 aa · LXL04_029495|LXL04_029495|OH1004|PROTEIN

MVELPVMKNRCRKGIWRCTLGKKRTMRGEFWPLPHVSLVKSENQNLNRNNNSITECKAQGIKALGLVCHVSNEQQRKNLIQQTVQKYGKIDVIVSNAAANPSAEN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029495`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029495

Location Chr06:92327209-92327619 (-)

Description Similar to Tropinone reductase-like 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g05530`	Involved with IBR3 and IBR10 in the peroxisomal beta- oxidation of indole-3-butyric acid (IBA) to form indole-3-acetic acid (IAA), a biologically active auxin.	Identification of two Arabidopsis genes encoding a peroxisomal oxidoreductase-like protein and an acyl-CoA synthetase-like protein that are required for responses to pro-auxins.2009 · DOI: 10.1007/s11103-008-9431-4 Conversion of endogenous indole-3-butyric acid to indole-3-acetic acid drives cell expansion in Arabidopsis seedlings.2010 · DOI: 10.1104/pp.110.157461

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029495 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001523 retinoid metabolic process Biological Process

GO:0006631 fatty acid metabolic process Biological Process

GO:0008202 steroid metabolic process Biological Process

GO:0042180 ketone metabolic process Biological Process

GO:0042574 retinal metabolic process Biological Process

GO:0048767 root hair elongation Biological Process

GO:0080024 indolebutyric acid metabolic process Biological Process

GO:0080026 response to indolebutyric acid Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005778 peroxisomal membrane Cellular Component

KEGG gene cross-reference

ath:AT4G05530

bta:281360

mmu:28200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.267

Rank 1 · LXL04_029495 · OH-1004

Mitochondrion0.265

Rank 2 · LXL04_029495 · OH-1004

Extracellular0.204

Rank 3 · LXL04_029495 · OH-1004

Nucleus0.131

Rank 4 · LXL04_029495 · OH-1004

Peroxisome0.059

Rank 5 · LXL04_029495 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00106.32adh_short45-100 aa

PF13561.13adh_short_C250-102 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029495	`PF00106.32`	adh_short	45	100	5e-08	33.4
LXL04_029495	`PF13561.13`	adh_short_C2	50	102	1.4e-06	28.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S9W2`	Arabidopsis thaliana	Short-chain dehydrogenase/reductase SDRA	50.000%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card