LXL04_029484 | RubberDandelionOmics

Gene overview

LXL04_029484

Reference: OH-1004 Chr: Chr06 Coordinates: 91955122-91957375 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

444 bp · LXL04_029484|LXL04_029484|OH1004|cDNA

atgtCTGATTCTCACTCTAAGTTGACCAAATCGAGGCACTCGTGCCGGTTctcccggttttggcagattcgcgtacttttatcACCTAGTAATGTCTGCTCATCTAAGGTATTctcacttttgtggggttttcgggtaggaaaccgggtcccgaacagacccgtaatttgctgggatttacGTAATCAAATCAGCTTACATGTTCTGAATCCGACAAAGTATTCCGTTGAAGAAGTCGTTACAGGAGTCGATGAGACTAA...

CDS

Download CDS FASTA

444 bp · LXL04_029484|LXL04_029484|OH1004|CDS

ATGTCTGATTCTCACTCTAAGTTGACCAAATCGAGGCACTCGTGCCGGTTCTCCCGGTTTTGGCAGATTCGCGTACTTTTATCACCTAGTAATGTCTGCTCATCTAAGGTATTCTCACTTTTGTGGGGTTTTCGGGTAGGAAACCGGGTCCCGAACAGACCCGTAATTTGCTGGGATTTACGTAATCAAATCAGCTTACATGTTCTGAATCCGACAAAGTATTCCGTTGAAGAAGTCGTTACAGGAGTCGATGAGACTAA...

Protein

Download Protein FASTA

147 aa · LXL04_029484|LXL04_029484|OH1004|PROTEIN

MSDSHSKLTKSRHSCRFSRFWQIRVLLSPSNVCSSKVFSLLWGFRVGNRVPNRPVICWDLRNQISLHVLNPTKYSVEEVVTGVDETNLHRTWIKVVGTRNTRERSSKHENMCWRIWHLTHKKKQLLESLIHLGHINRDRMRPTVGNK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029484`
TK1151 ID	TkA07G432100
OH-1004 ID	LXL04_029484
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	91.000
Protein coverage (%)	TK1151 69.027 / OH-1004 53.061 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029484

Location Chr06:91955122-91957375 (+)

Description Similar to SPS2: Probable sucrose-phosphate synthase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g04920`	Plays a role in photosynthetic sucrose synthesis by catalyzing the rate-limiting step of sucrose biosynthesis from UDP-glucose and fructose- 6-phosphate.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0919400`	Plays a role in photosynthetic sucrose synthesis by catalyzing the rate-limiting step of sucrose biosynthesis from UDP-glucose and fructose- 6-phosphate.	No verified direct reference in this release
`UniProt: A2WYE9`	Plays a role in photosynthetic sucrose synthesis by catalyzing the rate-limiting step of sucrose biosynthesis from UDP-glucose and fructose- 6-phosphate.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029484 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005986 sucrose biosynthetic process Biological Process

GO:0005794 Golgi apparatus Cellular Component

GO:0046524 sucrose-phosphate synthase activity Molecular Function

KEGG gene cross-reference

ath:AT1G04920

dosa:Os01g0919400

osa:4324364

zma:542711

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.372

Rank 1 · LXL04_029484 · OH-1004

Cytoplasm0.292

Rank 2 · LXL04_029484 · OH-1004

Nucleus0.236

Rank 3 · LXL04_029484 · OH-1004

Cell membrane0.092

Rank 4 · LXL04_029484 · OH-1004

Endoplasmic reticulum0.044

Rank 5 · LXL04_029484 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RY24`	Arabidopsis thaliana	Probable sucrose-phosphate synthase 3	82.456%	Swiss-Prot	weak database homology
`Q0JGK4`	Oryza sativa subsp. japonica	Probable sucrose-phosphate synthase 1	70.769%	Swiss-Prot	weak database homology
`A2WYE9`	Oryza sativa subsp. indica	Probable sucrose-phosphate synthase 1	70.769%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card