LXL04_029407 | RubberDandelionOmics

Gene overview

LXL04_029407

Reference: OH-1004 Chr: Chr06 Coordinates: 89268634-89269150 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

486 bp · LXL04_029407|LXL04_029407|OH1004|cDNA

ATGAAACTCTCCTTGTCTCTTGCATCTTCAAAGAATCCATCAAAACCCTCGAAATCCACCTCCTGTTCTTCAATGGATCAAGATAATCAATCCCCGAAAAAGGAATTTGTAACAGAGTTCGATTCATCCCTAACCCTAGCCGATTCCAATTCCAAGAGAACTATCCAAACGAAGAACATCGATCTACCCATCAAATCCGACGATCCAAATCTTAAATTCGAAGTAGACCCCAACTCAACTGACGAACCCATCAACTCCCA...

CDS

Download CDS FASTA

486 bp · LXL04_029407|LXL04_029407|OH1004|CDS

ATGAAACTCTCCTTGTCTCTTGCATCTTCAAAGAATCCATCAAAACCCTCGAAATCCACCTCCTGTTCTTCAATGGATCAAGATAATCAATCCCCGAAAAAGGAATTTGTAACAGAGTTCGATTCATCCCTAACCCTAGCCGATTCCAATTCCAAGAGAACTATCCAAACGAAGAACATCGATCTACCCATCAAATCCGACGATCCAAATCTTAAATTCGAAGTAGACCCCAACTCAACTGACGAACCCATCAACTCCCA...

Protein

Download Protein FASTA

161 aa · LXL04_029407|LXL04_029407|OH1004|PROTEIN

MKLSLSLASSKNPSKPSKSTSCSSMDQDNQSPKKEFVTEFDSSLTLADSNSKRTIQTKNIDLPIKSDDPNLKFEVDPNSTDEPINSHISYGLNVRTKKDCPSDRDPEVGRSESLSSINHLMLMKMRSDLKILPEDKGMAEFEDVSVEELMPALSKGYGWYE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029407`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029407

Location Chr06:89268634-89269150 (+)

Description Similar to MOS2: Protein MOS2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g33520`	Required for innate and induced resistance to pathogens such as compatible and incompatible isolates of P.syringae and P.parasitica.	MOS2, a protein containing G-patch and KOW motifs, is essential for innate immunity in Arabidopsis thaliana.2005 · DOI: 10.1016/j.cub.2005.09.038

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029407 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000398 mRNA splicing, via spliceosome Biological Process

GO:0002758 innate immune response-activating signaling pathway Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0005634 nucleus Cellular Component

GO:0005681 spliceosomal complex Cellular Component

GO:0003723 RNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G33520

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.894

Rank 1 · LXL04_029407 · OH-1004

Cytoplasm0.179

Rank 2 · LXL04_029407 · OH-1004

Cell membrane0.034

Rank 3 · LXL04_029407 · OH-1004

Endoplasmic reticulum0.021

Rank 4 · LXL04_029407 · OH-1004

Mitochondrion0.018

Rank 5 · LXL04_029407 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C801`	Arabidopsis thaliana	Protein MOS2	38.286%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card