LXL04_029372 | RubberDandelionOmics

Gene overview

LXL04_029372

Reference: OH-1004 Chr: Chr06 Coordinates: 88601300-88602340 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1041 bp · LXL04_029372|LXL04_029372|OH1004|cDNA

ATGGATAATTCTGATTATTCGAGGAATCGGAACAATGAGCATTTGGGCGTGAACAAAATTGGGAAAGCGATCAGGAAAAGTCCCTTACACCAACCAAATTTCGCGAATCCGGCCAGGCAACAACCTCAACCGCAAGTATACAATATCAACAAGAACGATTTTCAAAGTATTGTTCAACAGCTCACCGGTTCACCTTCCCGGAATTCCCAAGAGCCACTTCCGAGACCTCCTCAGAACTCACCACGACCACCTAGCAACCG...

CDS

Download CDS FASTA

1041 bp · LXL04_029372|LXL04_029372|OH1004|CDS

ATGGATAATTCTGATTATTCGAGGAATCGGAACAATGAGCATTTGGGCGTGAACAAAATTGGGAAAGCGATCAGGAAAAGTCCCTTACACCAACCAAATTTCGCGAATCCGGCCAGGCAACAACCTCAACCGCAAGTATACAATATCAACAAGAACGATTTTCAAAGTATTGTTCAACAGCTCACCGGTTCACCTTCCCGGAATTCCCAAGAGCCACTTCCGAGACCTCCTCAGAACTCACCACGACCACCTAGCAACCG...

Protein

Download Protein FASTA

346 aa · LXL04_029372|LXL04_029372|OH1004|PROTEIN

MDNSDYSRNRNNEHLGVNKIGKAIRKSPLHQPNFANPARQQPQPQVYNINKNDFQSIVQQLTGSPSRNSQEPLPRPPQNSPRPPSNRLQRIRPSPLAPLNVNRPRMPIHHMGQEQMSQMPLHRPPNGAVLGAPPYNGNFARPTHHGPPRQQPPPPPMNSGDHTGWANTAESPISAYMRYLQHSIIDSTQGHPQSHPQYQQNPQGQHQQHQHQHQQQQQPGLLPYPLMPSPRMNGAPPLPSPRMNGPPPLPPLPSPRMNGP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029372`
TK1151 ID	TkA07G307720
OH-1004 ID	LXL04_029372
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	68.700
Protein coverage (%)	TK1151 71.512 / OH-1004 47.977 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029372

Location Chr06:88601300-88602340 (-)

Description Similar to IKU1: Protein HAIKU1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g35230`	Modulates seed size by negatively regulating the cellularization of syncytial endosperm.	The VQ motif protein IKU1 regulates endosperm growth and seed size in Arabidopsis.2010 · DOI: 10.1111/j.1365-313x.2010.04271.x
`At1g78310`	Functions as a negative regulator of salt stress response.	No verified direct reference in this release
`At1g32585`	May function as negative regulator of plant defense.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029372 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006883 intracellular sodium ion homeostasis Biological Process

GO:0006952 defense response Biological Process

GO:0009960 endosperm development Biological Process

GO:0030007 intracellular potassium ion homeostasis Biological Process

GO:0080113 regulation of seed growth Biological Process

GO:1901001 negative regulation of response to salt stress Biological Process

GO:0005634 nucleus Cellular Component

GO:0043078 polar nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G32585

ath:AT1G78310

ath:AT2G35230

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.939

Rank 1 · LXL04_029372 · OH-1004

Cytoplasm0.209

Rank 2 · LXL04_029372 · OH-1004

Endoplasmic reticulum0.033

Rank 3 · LXL04_029372 · OH-1004

Cell membrane0.031

Rank 4 · LXL04_029372 · OH-1004

Mitochondrion0.010

Rank 5 · LXL04_029372 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05678.20VQ42-66 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029372	`PF05678.20`	VQ	42	66	4e-08	33.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82170`	Arabidopsis thaliana	Protein HAIKU1	44.009%	Swiss-Prot	moderate database homology
`Q9M9F0`	Arabidopsis thaliana	VQ motif-containing protein 9	38.312%	Swiss-Prot	weak database homology
`Q3ED38`	Arabidopsis thaliana	VQ motif-containing protein 5	43.333%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card