Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1119 bp · LXL04_029365|LXL04_029365|OH1004|cDNA
atgaaaaatattCCGGTGATTCTTATGGGCTGCGGAGGCGTTGGGAGACAACTCCTTCAACACATCGTCTCCTGTCGAACCATACACGCAAACAAGGGAATTCACTTGCGAGTTGTTGGTGTATGCGACAGTAAATCATTTCTTGTTGCACCAGACGTGTTGACCATGGAGTTCAATGATACATTTTTGATGGACATTTGCCAAATCAAGTCAAACGGCATGTCCCTCCAAACATGTGTTGACTCTGGTAAATGTGAATC...
1119 bp · LXL04_029365|LXL04_029365|OH1004|CDS
ATGAAAAATATTCCGGTGATTCTTATGGGCTGCGGAGGCGTTGGGAGACAACTCCTTCAACACATCGTCTCCTGTCGAACCATACACGCAAACAAGGGAATTCACTTGCGAGTTGTTGGTGTATGCGACAGTAAATCATTTCTTGTTGCACCAGACGTGTTGACCATGGAGTTCAATGATACATTTTTGATGGACATTTGCCAAATCAAGTCAAACGGCATGTCCCTCCAAACATGTGTTGACTCTGGTAAATGTGAATC...
Protein
Download Protein FASTA372 aa · LXL04_029365|LXL04_029365|OH1004|PROTEIN
MKNIPVILMGCGGVGRQLLQHIVSCRTIHANKGIHLRVVGVCDSKSFLVAPDVLTMEFNDTFLMDICQIKSNGMSLQTCVDSGKCESFSYPESTKKLTNIASSLAFTLVDCSASSETVKIITQAVNSGCCAVLANKKPLTSSMEDFDNLFLHPRRIRHESTVGAGLPIISSLNRILSSGDTIYRIIGSLSGTLGYVMSEVEDGKPFSEVVKAAQALGYTEPDPRDDLSGMDVARKGLILARLLGQRMDMSSIKIESLYPD...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_029365 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_029365 |
|---|---|
| Location | Chr06:88378272-88380703 (-) |
| Description | Similar to Bifunctional aspartokinase/homoserine dehydrogenase, chloroplastic (Fragment) |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0009067 aspartate family amino acid biosynthetic process Biological Process GO:0009086 methionine biosynthetic process Biological Process GO:0009088 L-threonine biosynthetic process Biological Process GO:0009089 L-lysine biosynthetic process via diaminopimelate Biological Process GO:0009090 L-homoserine biosynthetic process Biological Process GO:0051289 protein homotetramerization Biological Process GO:0009507 chloroplast Cellular Component GO:0004072 aspartate kinase activity Molecular Function GO:0004412 homoserine dehydrogenase activity Molecular Function GO:0005524 ATP binding Molecular Function GO:0042802 identical protein binding Molecular Function GO:0046872 metal ion binding Molecular Function |
| KEGG gene cross-reference | bab:bbp_183 bas:BUsg_188 ecj:JW0001 eco:b0002 ecoc:C3026_00010 zma:542249 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF03447.23NAD_binding_310-150 aaPF00742.25Homoserine_dh167-365 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_029365 | PF03447.23 | NAD_binding_3 | 10 | 150 | 4.2e-06 | 28.2 |
| LXL04_029365 | PF00742.25 | Homoserine_dh | 167 | 365 | 2.3e-49 | 168.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.