RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_029351
Reference: OH-1004 Chr: Chr06 Coordinates: 88173936-88176247 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1545 bp · LXL04_029351|LXL04_029351|OH1004|cDNA

ATGGAATCGATTCCATCCTCCATGGACAATCCCTCAATATCCGATATGAACAATCAATCCTCAACCTCTCCATCTCAATCGAACCCTCCATCAAAATTACAAGAACCCACAACCCCATCATCTCTAAATTATTACCACCCATCTCCTTCACGCACCATCTACAGCGATCGCTTCATCCCCTGCCGATCCGCCTCCAATTTCGCCCTCTTTGACATCTcccctcctcctcctcctccgcCGTCCGATGCTGCTCGTGGTGA...

CDS

Download CDS FASTA

1545 bp · LXL04_029351|LXL04_029351|OH1004|CDS

ATGGAATCGATTCCATCCTCCATGGACAATCCCTCAATATCCGATATGAACAATCAATCCTCAACCTCTCCATCTCAATCGAACCCTCCATCAAAATTACAAGAACCCACAACCCCATCATCTCTAAATTATTACCACCCATCTCCTTCACGCACCATCTACAGCGATCGCTTCATCCCCTGCCGATCCGCCTCCAATTTCGCCCTCTTTGACATCTCCCCTCCTCCTCCTCCTCCGCCGTCCGATGCTGCTCGTGGTGA...

Protein

Download Protein FASTA

514 aa · LXL04_029351|LXL04_029351|OH1004|PROTEIN

MESIPSSMDNPSISDMNNQSSTSPSQSNPPSKLQEPTTPSSLNYYHPSPSRTIYSDRFIPCRSASNFALFDISPPPPPPPSDAARGEDNSSSSAAYTALLRTALFGSDLGFVVPPGTPDKKSFSVNTSPVSQNIFRFKSETRQSLHSLSPLGFDDHSPGVSHSPVKAPRKVPRSPYKVHIFNNFSYFDDIPSDHPVSVLDAPALQDDFYLNLVDWSSHNVLAVGLGNCVYLWNACSSKVTKLCDLGIDDSVCSVGWAQRG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_029351
TK1151 IDTkA07G306150
OH-1004 IDLXL04_029351
Relationship / confidenceSequence Supported Annotation Or Model Conflict / Review
Protein identity (%)100.000
Protein coverage (%)TK1151 100.000 / OH-1004 44.553
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_029351
LocationChr06:88173936-88176247 (+)
DescriptionSimilar to FZR2: Protein FIZZY-RELATED 2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At4g22910 Activator protein that regulates the ubiquitin ligase activity and substrate specificity of the anaphase promoting complex/cyclosome (APC/C).
Arabidopsis anaphase-promoting complexes: multiple activators and wide range of substrates might keep APC perpetually busy.2005 · DOI: 10.4161/cc.4.8.1856
FZR2/CCS52A1 expression is a determinant of endoreduplication and cell expansion in Arabidopsis.2009 · DOI: 10.1104/pp.108.132449
APC/C-CCS52A complexes control meristem maintenance in the Arabidopsis root.2009 · DOI: 10.1073/pnas.0901193106
At4g11920 Activator protein that regulates the ubiquitin ligase activity and substrate specificity of the anaphase promoting complex/cyclosome (APC/C).
Arabidopsis anaphase-promoting complexes: multiple activators and wide range of substrates might keep APC perpetually busy.2005 · DOI: 10.4161/cc.4.8.1856
APC/C-CCS52A complexes control meristem maintenance in the Arabidopsis root.2009 · DOI: 10.1073/pnas.0901193106
At5g13840 Activator protein that regulates the ubiquitin ligase activity and substrate specificity of the anaphase promoting complex/cyclosome (APC/C).
Arabidopsis anaphase-promoting complexes: multiple activators and wide range of substrates might keep APC perpetually busy.2005 · DOI: 10.4161/cc.4.8.1856

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_029351 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0008361 regulation of cell size Biological Process
GO:0009624 response to nematode Biological Process
GO:0009825 multidimensional cell growth Biological Process
GO:0009877 nodulation Biological Process
GO:0010091 trichome branching Biological Process
GO:0010492 maintenance of shoot apical meristem identity Biological Process
GO:0016567 protein ubiquitination Biological Process
GO:0030154 cell differentiation Biological Process
GO:0031145 anaphase-promoting complex-dependent catabolic process Biological Process
GO:0032877 positive regulation of DNA endoreduplication Biological Process
GO:0042023 DNA endoreduplication Biological Process
GO:0051301 cell division Biological Process
KEGG gene cross-reference
ath:AT4G11920
ath:AT4G22910
ath:AT5G13840
mtr:25493638
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.704
Rank 1 · LXL04_029351 · OH-1004
Cytoplasm0.325
Rank 2 · LXL04_029351 · OH-1004
Cell membrane0.043
Rank 3 · LXL04_029351 · OH-1004
Lysosome / Vacuole0.030
Rank 4 · LXL04_029351 · OH-1004
Endoplasmic reticulum0.024
Rank 5 · LXL04_029351 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24807.2WD40_CDC20-Fz199-488 aa
PF24817.2WD40_WDHD1_1st211-300 aa
PF23414.2Beta-prop_EML_2217-382 aa
PF23381.2Beta-prop_IFT122_1st218-312 aa
PF23389.2Beta-prop_WDR19_1st219-312 aa
PF25173.2Beta-prop_WDR3_1st220-316 aa
PF25171.2Beta-prop_WDR36-Utp21_1st227-358 aa
PF24814.2WD40_Prp19240-299 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_029351PF24807.2WD40_CDC20-Fz1994884.1e-127424.2
LXL04_029351PF24817.2WD40_WDHD1_1st2113002.8e-2796.4
LXL04_029351PF23414.2Beta-prop_EML_22173825e-2485.8
LXL04_029351PF23381.2Beta-prop_IFT122_1st2183124e-38132.0
LXL04_029351PF23389.2Beta-prop_WDR19_1st2193122.4e-1763.7
LXL04_029351PF25173.2Beta-prop_WDR3_1st2203161.3e-38133.2
LXL04_029351PF25171.2Beta-prop_WDR36-Utp21_1st2273581.1e-0732.3
LXL04_029351PF24814.2WD40_Prp192402991.7e-2487.1
LXL04_029351PF24796.2WDR552454933.2e-1246.8
LXL04_029351PF12894.14ANAPC4_WD402463002.4e-1350.8
LXL04_029351PF25175.2Beta-prop_WDR52484142.6e-34119.6
LXL04_029351PF25172.2Beta-prop_WDR3_2nd2483122.3e-2073.7
LXL04_029351PF25174.2Beta-prop_THOC32493212.5e-38132.4
LXL04_029351PF25047.1Beta-prop_TEP1_2nd2514231.1e-1661.6
LXL04_029351PF24782.3WD40_MABP1-WDR62_2nd2514896.6e-1452.3
LXL04_029351PF24814.2WD40_Prp193014891.7e-2487.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q8L3Z8Arabidopsis thalianaProtein FIZZY-RELATED 276.890%Swiss-Protstrong database homology
Q8VZS9Arabidopsis thalianaProtein FIZZY-RELATED 169.141%Swiss-Protstrong database homology
Q8LPL5Arabidopsis thalianaProtein FIZZY-RELATED 361.159%Swiss-Protstrong database homology

JBrowse

View in Genome Browser