LXL04_029308 | RubberDandelionOmics

Gene overview

LXL04_029308

Reference: OH-1004 Chr: Chr06 Coordinates: 87006524-87009765 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1923 bp · LXL04_029308|LXL04_029308|OH1004|cDNA

ATGGCGGCGACGACAATGGCGACAGCGGCGGGGGCGGTGGTGTTATTGTACTATGTATTGGCTCGGAGAATGACTTCGGCTGATGCAAAGGCTGCCGAGGATGATGAGGGACGAGAATACATGAAATCAAGTAAATCGAAGAGGAAGATCGCGCAGAGGAGGCCAGCTCAGGCGCCTGCCACGTGGTTTGAAACGATTTCGACTCTCTCTGAGACGCTTAGATTCACGTATTCAGAAACCCTAGGAAAATGGCCTATTGG...

CDS

Download CDS FASTA

1923 bp · LXL04_029308|LXL04_029308|OH1004|CDS

ATGGCGGCGACGACAATGGCGACAGCGGCGGGGGCGGTGGTGTTATTGTACTATGTATTGGCTCGGAGAATGACTTCGGCTGATGCAAAGGCTGCCGAGGATGATGAGGGACGAGAATACATGAAATCAAGTAAATCGAAGAGGAAGATCGCGCAGAGGAGGCCAGCTCAGGCGCCTGCCACGTGGTTTGAAACGATTTCGACTCTCTCTGAGACGCTTAGATTCACGTATTCAGAAACCCTAGGAAAATGGCCTATTGG...

Protein

Download Protein FASTA

640 aa · LXL04_029308|LXL04_029308|OH1004|PROTEIN

MAATTMATAAGAVVLLYYVLARRMTSADAKAAEDDEGREYMKSSKSKRKIAQRRPAQAPATWFETISTLSETLRFTYSETLGKWPIGDLAFGINYLLRRQGNVQVASVYAGENSIQLKGPEIIAELKHCLRLLTLCMLFSKKPFPVFLESAGFSEADVLLHKPKAGLLKPAFTIICDKESKCFLLLIRGTHSIKDTLTAATGAVVPFHHSVLHDGGISNLILGYAHCGMVAAARWIAKLSIPFLLQALKDNPGYEVKIVG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029308`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_029308`
Location	Chr06:87006524-87009765 (+)
Description	Similar to DAGLA: Sn1-specific diacylglycerol lipase alpha
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_029308` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0019369 arachidonate metabolic process Biological Process GO:0045471 response to ethanol Biological Process GO:0046340 diacylglycerol catabolic process Biological Process GO:0071926 endocannabinoid signaling pathway Biological Process GO:1901696 cannabinoid biosynthetic process Biological Process GO:0005886 plasma membrane Cellular Component GO:0031901 early endosome membrane Cellular Component GO:0004465 lipoprotein lipase activity Molecular Function GO:0016787 hydrolase activity Molecular Function GO:0046872 metal ion binding Molecular Function GO:0047372 monoacylglycerol lipase activity Molecular Function
KEGG gene cross-reference	hsa:747 mmu:269060 rno:309207 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.460

Rank 1 · LXL04_029308 · OH-1004

Mitochondrion0.125

Rank 2 · LXL04_029308 · OH-1004

Cytoplasm0.116

Rank 3 · LXL04_029308 · OH-1004

Endoplasmic reticulum0.111

Rank 4 · LXL04_029308 · OH-1004

Nucleus0.099

Rank 5 · LXL04_029308 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03893.23Lipase3_N52-127 aa

PF01764.32Lipase_3185-333 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029308	`PF03893.23`	Lipase3_N	52	127	6.1e-18	65.3
LXL04_029308	`PF01764.32`	Lipase_3	185	333	6.9e-23	81.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card