LXL04_029307 | RubberDandelionOmics

Gene overview

LXL04_029307

Reference: OH-1004 Chr: Chr06 Coordinates: 86969862-86970339 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

393 bp · LXL04_029307|LXL04_029307|OH1004|cDNA

ATGACATCAACTGAGGGTGACAAACTGATACTAAGAGGACTAATGTTTCATGGGTATCACGGAGTACATcaagaggaaaagaaacttGGTCAAAAGTTTTTAATAGATATAGACGCGTGGATGGATCTTCGGGCACCCGGTCAGTCAGATAACATGTCTGATACAGTCAGTTATACAGACATATATCGCATTGCGAAACATATTGTGGAAGGTCCTTCACAGAACCTTCTAGAATCAGTGGCTCAACTGATTGCAACAAC...

CDS

Download CDS FASTA

393 bp · LXL04_029307|LXL04_029307|OH1004|CDS

ATGACATCAACTGAGGGTGACAAACTGATACTAAGAGGACTAATGTTTCATGGGTATCACGGAGTACATCAAGAGGAAAAGAAACTTGGTCAAAAGTTTTTAATAGATATAGACGCGTGGATGGATCTTCGGGCACCCGGTCAGTCAGATAACATGTCTGATACAGTCAGTTATACAGACATATATCGCATTGCGAAACATATTGTGGAAGGTCCTTCACAGAACCTTCTAGAATCAGTGGCTCAACTGATTGCAACAAC...

Protein

Download Protein FASTA

130 aa · LXL04_029307|LXL04_029307|OH1004|PROTEIN

MTSTEGDKLILRGLMFHGYHGVHQEEKKLGQKFLIDIDAWMDLRAPGQSDNMSDTVSYTDIYRIAKHIVEGPSQNLLESVAQLIATTTLNNHSRISAVRVVVGKPHVAVPGPLDYLGIEIIRYRTIDMPL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029307`
TK1151 ID	TkA07G299770
OH-1004 ID	LXL04_029307
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029307

Location Chr06:86969862-86970339 (+)

Description Similar to FOLB2: Dihydroneopterin aldolase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g62980`	Catalyzes the conversion of 7,8-dihydroneopterin into 6- hydroxymethyl-7,8-dihydropterin, a biosynthetic precursor of the vitamin tetrahydrofolate.	Folate biosynthesis in higher plants. cDNA cloning, heterologous expression, and characterization of dihydroneopterin aldolases.2004 · DOI: 10.1104/pp.103.038430
`At3g11750`	Catalyzes the conversion of 7,8-dihydroneopterin into 6- hydroxymethyl-7,8-dihydropterin, a biosynthetic precursor of the vitamin tetrahydrofolate.	Folate biosynthesis in higher plants. cDNA cloning, heterologous expression, and characterization of dihydroneopterin aldolases.2004 · DOI: 10.1104/pp.103.038430
`At3g21730`	Catalyzes the conversion of 7,8-dihydroneopterin into 6-hydroxymethyl-7,8-dihydropterin, a biosynthetic precursor of the vitamin tetrahydrofolate.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029307 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0046654 tetrahydrofolate biosynthetic process Biological Process

GO:0046656 folic acid biosynthetic process Biological Process

GO:0140964 intracellular auxin homeostasis Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004150 dihydroneopterin aldolase activity Molecular Function

GO:0016853 isomerase activity Molecular Function

KEGG gene cross-reference

ath:AT3G11750

ath:AT3G21730

ath:AT5G62980

bsu:BSU00780

sep:SE_2268

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.494

Rank 1 · LXL04_029307 · OH-1004

Mitochondrion0.306

Rank 2 · LXL04_029307 · OH-1004

Nucleus0.222

Rank 3 · LXL04_029307 · OH-1004

Peroxisome0.093

Rank 4 · LXL04_029307 · OH-1004

Cell membrane0.081

Rank 5 · LXL04_029307 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02152.24FolB10-120 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029307	`PF02152.24`	FolB	10	120	2.3e-33	115.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FM54`	Arabidopsis thaliana	Dihydroneopterin aldolase 2	59.350%	Swiss-Prot	strong database homology
`Q9SF23`	Arabidopsis thaliana	Dihydroneopterin aldolase 1	56.098%	Swiss-Prot	strong database homology
`Q6GKX5`	Arabidopsis thaliana	Probable dihydroneopterin aldolase 3	46.825%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card