LXL04_029291 | RubberDandelionOmics

Gene overview

LXL04_029291

Reference: OH-1004 Chr: Chr06 Coordinates: 86299249-86302706 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1605 bp · LXL04_029291|LXL04_029291|OH1004|cDNA

ATGCAGTCATCATCGTCTTCATCATCGTCGTCGTCTGTAACGTTAGAAACCAATAATGCCGTCAGAATTTTATCCAAATTGACACAATTCGCATTCGATTCCAACTCTAGCTCCCTGAGTTTAGAGGGGTATTCTTCGATTCTCTCTAACTTCGTGCAGTACGACAGAAAAGTTGGGGATTTTTGGGCCGGTGGGAGAAGAAAATCATTAAAAGTGGTGGGTTCTTTGAATTCAGGAACCAGAGGCGCGTCTAGTATCAA...

CDS

Download CDS FASTA

1605 bp · LXL04_029291|LXL04_029291|OH1004|CDS

ATGCAGTCATCATCGTCTTCATCATCGTCGTCGTCTGTAACGTTAGAAACCAATAATGCCGTCAGAATTTTATCCAAATTGACACAATTCGCATTCGATTCCAACTCTAGCTCCCTGAGTTTAGAGGGGTATTCTTCGATTCTCTCTAACTTCGTGCAGTACGACAGAAAAGTTGGGGATTTTTGGGCCGGTGGGAGAAGAAAATCATTAAAAGTGGTGGGTTCTTTGAATTCAGGAACCAGAGGCGCGTCTAGTATCAA...

Protein

Download Protein FASTA

534 aa · LXL04_029291|LXL04_029291|OH1004|PROTEIN

MQSSSSSSSSSSVTLETNNAVRILSKLTQFAFDSNSSSLSLEGYSSILSNFVQYDRKVGDFWAGGRRKSLKVVGSLNSGTRGASSINKFFNEFNKFVRFHCDKIPLGFASLKVSSGSISGLEDNGGVLENEMPLSGFESNGKKKVLILMSDTGGGHRASAEAIKWAFNEKFGDEYEVFVTDLWTDHTPWPFNQLPRSYNFLVKHGSLWRMTYYASAPRLIHQSNFAATSTFIAREVAKGLMKYRPDIIISVHPLMQHVPL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029291`
TK1151 ID	TkA07G297590
OH-1004 ID	LXL04_029291
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029291

Location Chr06:86299249-86302706 (+)

Description Similar to MGD A: Probable monogalactosyldiacylglycerol synthase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g31780`	Involved in the synthesis of the major structural component of photosynthetic membranes.	Galactolipid deficiency and abnormal chloroplast development in the Arabidopsis MGD synthase 1 mutant.2000 · DOI: 10.1073/pnas.100132197 Two types of MGDG synthase genes, found widely in both 16:3 and 18:3 plants, differentially mediate galactolipid syntheses in photosynthetic and nonphotosynthetic tissues in Arabidopsis thaliana.2001 · DOI: 10.1073/pnas.181331498 Inducible knockdown of MONOGALACTOSYLDIACYLGLYCEROL SYNTHASE1 reveals roles of galactolipids in organelle differentiation in Arabidopsis cotyledons.2014 · DOI: 10.1104/pp.114.250050

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029291 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009247 glycolipid biosynthetic process Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010027 thylakoid membrane organization Biological Process

GO:0019375 galactolipid biosynthetic process Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009706 chloroplast inner membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:0008194 UDP-glycosyltransferase activity Molecular Function

GO:0035250 UDP-galactosyltransferase activity Molecular Function

KEGG gene cross-reference

ag:CAB56218

ath:AT4G31780

csv:101209030

gmx:547469

nta:107787940

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.972

Rank 1 · LXL04_029291 · OH-1004

Mitochondrion0.032

Rank 2 · LXL04_029291 · OH-1004

Cytoplasm0.030

Rank 3 · LXL04_029291 · OH-1004

Peroxisome0.023

Rank 4 · LXL04_029291 · OH-1004

Nucleus0.023

Rank 5 · LXL04_029291 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06925.18MGDG_synth156-324 aa

PF04101.23Glyco_tran_28_C353-449 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029291	`PF06925.18`	MGDG_synth	156	324	7.9e-62	209.0
LXL04_029291	`PF04101.23`	Glyco_tran_28_C	353	449	3e-10	41.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O81770`	Arabidopsis thaliana	Monogalactosyldiacylglycerol synthase 1, chloroplastic	69.623%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card