LXL04_029279 | RubberDandelionOmics

Gene overview

LXL04_029279

Reference: OH-1004 Chr: Chr06 Coordinates: 85980605-85984878 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1440 bp · LXL04_029279|LXL04_029279|OH1004|cDNA

ATGGTTTCAATAAAGAAGAGGTTGAATTGCTGTACGAGGAACAGAGGAATCAGTGATAGCATCGACTTTGATCAACCACCGGACAGTATGCTCACTTCCTTTTCTCTTAAATTTCTAATCATACTCATAAAAGAAACCGATGAAATTATGACATATAACGGGCTAGAGACCTGCATTCTGAATTCCAACTCTTACAAGGATCACGAAAGTGATAAAAGAGACAGATGTCCAACCGAGTCACCAGAAGAAGATATATCGAG...

CDS

Download CDS FASTA

1440 bp · LXL04_029279|LXL04_029279|OH1004|CDS

ATGGTTTCAATAAAGAAGAGGTTGAATTGCTGTACGAGGAACAGAGGAATCAGTGATAGCATCGACTTTGATCAACCACCGGACAGTATGCTCACTTCCTTTTCTCTTAAATTTCTAATCATACTCATAAAAGAAACCGATGAAATTATGACATATAACGGGCTAGAGACCTGCATTCTGAATTCCAACTCTTACAAGGATCACGAAAGTGATAAAAGAGACAGATGTCCAACCGAGTCACCAGAAGAAGATATATCGAG...

Protein

Download Protein FASTA

479 aa · LXL04_029279|LXL04_029279|OH1004|PROTEIN

MVSIKKRLNCCTRNRGISDSIDFDQPPDSMLTSFSLKFLIILIKETDEIMTYNGLETCILNSNSYKDHESDKRDRCPTESPEEDISSCCSSNNPSGSFFSHGIDDWEFMEKESPSYTLQYSDMEAMKEKFAKLLLGEDATGGRNGVSPALALSNAITHLAGSVFGELWKLEPLDEEKKNKWKREMDWLLSPTNHMIMTPKARGDVHLNLPALRKLDSMLLVNDLFTPYNQPIKFLYLSKVETLDSMTETEFWYEEGGSRA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029279`
TK1151 ID	TkA07G296250
OH-1004 ID	LXL04_029279
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	86.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029279

Location Chr06:85980605-85984878 (+)

Description Similar to ROPGEF14: Rop guanine nucleotide exchange factor 14

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g31650`	Guanine-nucleotide exchange factor (GEF) that acts as an activator of Rop (Rho of plants) GTPases by promoting the exchange of GDP for GTP.	No verified direct reference in this release
`At5g02010`	Guanine-nucleotide exchange factor (GEF) that acts as an activator of Rop (Rho of plants) GTPases by promoting the exchange of GDP for GTP.	RopGEF7 regulates PLETHORA-dependent maintenance of the root stem cell niche in Arabidopsis.2011 · DOI: 10.1105/tpc.111.085514
`At4g38430`	Guanine-nucleotide exchange factor (GEF) that acts as an activator of Rop (Rho of plants) GTPases by promoting the exchange of GDP for GTP.	Members of a novel class of Arabidopsis Rho guanine nucleotide exchange factors control Rho GTPase-dependent polar growth.2006 · DOI: 10.1105/tpc.105.036434 ROPGEF1 and ROPGEF4 are functional regulators of ROP11 GTPase in ABA-mediated stomatal closure in Arabidopsis.2012 · DOI: 10.1016/j.febslet.2012.03.040 AtPRK2 promotes ROP1 activation via RopGEFs in the control of polarized pollen tube growth.2013 · DOI: 10.1093/mp/sss103
`At3g24620`	Guanine-nucleotide exchange factor (GEF) that acts as an activator of Rop (Rho of plants) GTPases by promoting the exchange of GDP for GTP.	Structural evidence for a common intermediate in small G protein-GEF reactions.2007 · DOI: 10.1016/j.molcel.2006.11.023
`At4g00460`	Guanine-nucleotide exchange factor (GEF) that acts as an activator of Rop (Rho of plants) GTPases by promoting the exchange of GDP for GTP.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029279 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009664 plant-type cell wall organization Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0080092 regulation of pollen tube growth Biological Process

GO:2000012 regulation of auxin polar transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016324 apical plasma membrane Cellular Component

GO:0005085 guanyl-nucleotide exchange factor activity Molecular Function

GO:0042802 identical protein binding Molecular Function

KEGG gene cross-reference

ath:AT1G31650

ath:AT3G24620

ath:AT4G00460

ath:AT4G38430

ath:AT5G02010

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.359

Rank 1 · LXL04_029279 · OH-1004

Cytoplasm0.298

Rank 2 · LXL04_029279 · OH-1004

Cell membrane0.282

Rank 3 · LXL04_029279 · OH-1004

Endoplasmic reticulum0.100

Rank 4 · LXL04_029279 · OH-1004

Plastid0.090

Rank 5 · LXL04_029279 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03759.19PRONE121-220 aa

PF03759.19PRONE240-470 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029279	`PF03759.19`	PRONE	121	220	2.7e-125	418.7
LXL04_029279	`PF03759.19`	PRONE	240	470	2.7e-125	418.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q56WM6`	Arabidopsis thaliana	Rop guanine nucleotide exchange factor 14	49.071%	Swiss-Prot	moderate database homology
`Q9LZN0`	Arabidopsis thaliana	Rop guanine nucleotide exchange factor 7	42.105%	Swiss-Prot	moderate database homology
`Q93ZY2`	Arabidopsis thaliana	Rop guanine nucleotide exchange factor 1	41.316%	Swiss-Prot	moderate database homology
`Q9LV40`	Arabidopsis thaliana	Rho guanine nucleotide exchange factor 8	40.533%	Swiss-Prot	moderate database homology
`A4IJ27`	Arabidopsis thaliana	Rop guanine nucleotide exchange factor 3	41.425%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card