LXL04_029199 | RubberDandelionOmics

Gene overview

LXL04_029199

Reference: OH-1004 Chr: Chr06 Coordinates: 83599656-83601991 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

786 bp · LXL04_029199|LXL04_029199|OH1004|cDNA

ATGCTTAAAATGGCGCGATGTCCCTTGCACGCCTTCACTGGGATTCTTGGTTTGCTCCTGCACGCCTTGGTTTGCTCCTGCACGCCTGATTCGTATCTGTTACACTTGATTTGGTTGATTATAAAAGAAGGCGACCCTCCGATCATCTTCTCCCCATCGTCGCCTTCCATTCAACACAGATCTGTCTGCCCTAAAGAATGCCGACGACCGATTAACAGCAACTCGAACAATTTTTCCGTTCAAACCTTCGTTCAATCTTC...

CDS

Download CDS FASTA

786 bp · LXL04_029199|LXL04_029199|OH1004|CDS

ATGCTTAAAATGGCGCGATGTCCCTTGCACGCCTTCACTGGGATTCTTGGTTTGCTCCTGCACGCCTTGGTTTGCTCCTGCACGCCTGATTCGTATCTGTTACACTTGATTTGGTTGATTATAAAAGAAGGCGACCCTCCGATCATCTTCTCCCCATCGTCGCCTTCCATTCAACACAGATCTGTCTGCCCTAAAGAATGCCGACGACCGATTAACAGCAACTCGAACAATTTTTCCGTTCAAACCTTCGTTCAATCTTC...

Protein

Download Protein FASTA

261 aa · LXL04_029199|LXL04_029199|OH1004|PROTEIN

MLKMARCPLHAFTGILGLLLHALVCSCTPDSYLLHLIWLIIKEGDPPIIFSPSSPSIQHRSVCPKECRRPINSNSNNFSVQTFVQSSSSSQIPIDLVRLGFQTLLKYSIVKRPKVLHMIWMKKKHKVWAVWAFLGFFCNSSGISGLCSLLQYVGRVLDQRMIWQQGFTTWMDHFCNNLYAIGPRDGCSSHSGMELICKGIIWLSAKTNLNMEQVFFSIATDIKQRLSETDSKDESSTIKINQPEGGGASGQSAHKSSTCC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029199`
TK1151 ID	TkA05G042090
OH-1004 ID	LXL04_029199
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	91.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029199

Location Chr06:83599656-83601991 (-)

Description Similar to RABE1A: Ras-related protein RABE1a

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g53610`	Involved in membrane trafficking from the Golgi to the plasma membrane.	No verified direct reference in this release
`At3g46060`	Involved in membrane trafficking from the Golgi to the plasma membrane.	No verified direct reference in this release
`At3g09900`	Involved in membrane trafficking from the Golgi to the plasma membrane.	No verified direct reference in this release
`At5g03520`	Involved in membrane trafficking from the Golgi to the plasma membrane.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029199 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006887 exocytosis Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0015031 protein transport Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0000325 plant-type vacuole Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0003924 GTPase activity Molecular Function

GO:0005525 GTP binding Molecular Function

KEGG gene cross-reference

ath:AT3G09900

ath:AT3G46060

ath:AT3G53610

ath:AT5G03520

bvg:104900163

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.375

Rank 1 · LXL04_029199 · OH-1004

Nucleus0.323

Rank 2 · LXL04_029199 · OH-1004

Mitochondrion0.189

Rank 3 · LXL04_029199 · OH-1004

Endoplasmic reticulum0.154

Rank 4 · LXL04_029199 · OH-1004

Cell membrane0.118

Rank 5 · LXL04_029199 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O24466`	Arabidopsis thaliana	Ras-related protein RABE1a	62.069%	Swiss-Prot	weak database homology
`P28186`	Arabidopsis thaliana	Ras-related protein RABE1c	62.069%	Swiss-Prot	weak database homology
`Q9SF91`	Arabidopsis thaliana	Ras-related protein RABE1e	56.140%	Swiss-Prot	weak database homology
`Q9LZD4`	Arabidopsis thaliana	Ras-related protein RABE1d	59.649%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card