Gene Card
Gene overview
cDNA / CDS / Protein Sequences
531 bp · LXL04_029139|LXL04_029139|OH1004|cDNA
ATGGCCGAAGAATACTTCTTGGTTCCTAATCGCCATCGGAGGCGCATCAGGCGCTCACTCAGCTCTGGTAACGACAGGGACGACAGAGGCTGGACTATGCTTCATGTTGGTGCTCGAAAAGGGGATCTTAATGAGGTAAAAAGGCTTCTCGATGAAGGAATGGATGCCAACGTGGCAGCACTAGGCCCCAAATCGCATGGGGTCACCCCTCTTCATCTTGCTGCTAAAGGTGGCCATGTAAAGGTTATGGATGAGCTCCT...
531 bp · LXL04_029139|LXL04_029139|OH1004|CDS
ATGGCCGAAGAATACTTCTTGGTTCCTAATCGCCATCGGAGGCGCATCAGGCGCTCACTCAGCTCTGGTAACGACAGGGACGACAGAGGCTGGACTATGCTTCATGTTGGTGCTCGAAAAGGGGATCTTAATGAGGTAAAAAGGCTTCTCGATGAAGGAATGGATGCCAACGTGGCAGCACTAGGCCCCAAATCGCATGGGGTCACCCCTCTTCATCTTGCTGCTAAAGGTGGCCATGTAAAGGTTATGGATGAGCTCCT...
Protein
Download Protein FASTA176 aa · LXL04_029139|LXL04_029139|OH1004|PROTEIN
MAEEYFLVPNRHRRRIRRSLSSGNDRDDRGWTMLHVGARKGDLNEVKRLLDEGMDANVAALGPKSHGVTPLHLAAKGGHVKVMDELLERGANIDARTKGACGWTPLHTAAKEKNRKAITFLIENGAFLPDNMEDTRFNPPVHYCHGLEWAYDEMKRFQQESGSSSGEGDGSYSSES
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_029139 |
|---|---|
| TK1151 ID | TkA07G278910 |
| OH-1004 ID | LXL04_029139 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_029139 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr06:81766401-81767002 (-) | |||||||||
| Description | Similar to PIA1: Phytochrome-interacting ankyrin-repeat protein 1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0001933 negative regulation of protein phosphorylation Biological Process GO:0006887 exocytosis Biological Process GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process GO:0007010 cytoskeleton organization Biological Process GO:0007165 signal transduction Biological Process GO:0009553 embryo sac development Biological Process GO:0009567 double fertilization forming a zygote and endosperm Biological Process GO:0009644 response to high light intensity Biological Process GO:0009744 response to sucrose Biological Process GO:0010218 response to far red light Biological Process GO:0031542 positive regulation of anthocyanin biosynthetic process Biological Process GO:0045199 maintenance of epithelial cell apical/basal polarity Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT5G07840 ath:AT5G61230 hsa:286 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF12796.14Ank_222-96 aaPF24521.3Ank_KRIT122-129 aaPF13637.13Ank_434-82 aaPF00023.37Ank66-98 aaPF13606.13Ank_366-95 aaPF13857.13Ank_566-109 aaPF12796.14Ank_267-127 aaPF13637.13Ank_471-122 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_029139 | PF12796.14 | Ank_2 | 22 | 96 | 1.9e-31 | 109.2 |
| LXL04_029139 | PF24521.3 | Ank_KRIT1 | 22 | 129 | 4.9e-07 | 30.3 |
| LXL04_029139 | PF13637.13 | Ank_4 | 34 | 82 | 1.7e-20 | 73.3 |
| LXL04_029139 | PF00023.37 | Ank | 66 | 98 | 1.7e-22 | 78.9 |
| LXL04_029139 | PF13606.13 | Ank_3 | 66 | 95 | 1.1e-18 | 65.9 |
| LXL04_029139 | PF13857.13 | Ank_5 | 66 | 109 | 3.2e-15 | 56.8 |
| LXL04_029139 | PF12796.14 | Ank_2 | 67 | 127 | 1.9e-31 | 109.2 |
| LXL04_029139 | PF13637.13 | Ank_4 | 71 | 122 | 1.7e-20 | 73.3 |
| LXL04_029139 | PF12796.14 | Ank_2 | 98 | 127 | 1.9e-31 | 109.2 |
| LXL04_029139 | PF00023.37 | Ank | 101 | 126 | 1.7e-22 | 78.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.