LXL04_028987 | RubberDandelionOmics

Gene overview

LXL04_028987

Reference: OH-1004 Chr: Chr06 Coordinates: 77049783-77050753 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

381 bp · LXL04_028987|LXL04_028987|OH1004|cDNA

ATGTCGAAGTTTGCTGGTCTGCTCGTGATTTGTGCTGTAATCCTTGTCACCCACATGATCGCGCTCGCATTTCCTGCCGTTGATGCCGCTTCAAGCGGTGCGGACCACCGTCTGGGGTGGCTTCCAACTACTACCTCCACCGTCGGCAGCAGATGCCGTGGATCTATGGCGGAATGTCTAGCCGAAGGCGCAGATCTGGAAATAGACGACATGGAGTTCACAATGGACAGTGAAACCAACCGGCGTATTTTAGCAAGCAA...

CDS

Download CDS FASTA

381 bp · LXL04_028987|LXL04_028987|OH1004|CDS

ATGTCGAAGTTTGCTGGTCTGCTCGTGATTTGTGCTGTAATCCTTGTCACCCACATGATCGCGCTCGCATTTCCTGCCGTTGATGCCGCTTCAAGCGGTGCGGACCACCGTCTGGGGTGGCTTCCAACTACTACCTCCACCGTCGGCAGCAGATGCCGTGGATCTATGGCGGAATGTCTAGCCGAAGGCGCAGATCTGGAAATAGACGACATGGAGTTCACAATGGACAGTGAAACCAACCGGCGTATTTTAGCAAGCAA...

Protein

Download Protein FASTA

126 aa · LXL04_028987|LXL04_028987|OH1004|PROTEIN

MSKFAGLLVICAVILVTHMIALAFPAVDAASSGADHRLGWLPTTTSTVGSRCRGSMAECLAEGADLEIDDMEFTMDSETNRRILASNRRYISYGSLSRNNVPCSRRGASYYNCRSGGWYAVGLSVL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_028987`
TK1151 ID	TkA07G258990
OH-1004 ID	LXL04_028987
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	90.600
Protein coverage (%)	TK1151 86.290 / OH-1004 92.857 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_028987

Location Chr06:77049783-77050753 (+)

Description Similar to RALFL33: Protein RALF-like 33

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g15800`	Cell signaling peptide that may regulate plant stress, growth, and development.	No verified direct reference in this release
`At1g02900`	Cell signaling peptide that may regulate plant stress, growth, and development.	A cytoplasmic Ca2+ functional assay for identifying and purifying endogenous cell signaling peptides in Arabidopsis seedlings: identification of AtRALF1 peptide.2008 · DOI: 10.1021/bi8001488 A conserved dibasic site is essential for correct processing of the peptide hormone AtRALF1 in Arabidopsis thaliana.2008 · DOI: 10.1016/j.febslet.2008.08.025
`At3g16570`	Cell signaling peptide that may regulate plant stress, growth, and development.	Regulation and processing of a plant peptide hormone, AtRALF23, in Arabidopsis.2009 · DOI: 10.1111/j.1365-313x.2009.03926.x
`At2g33775`	Cell signaling peptide that may regulate plant stress, growth, and development.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028987 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007267 cell-cell signaling Biological Process

GO:0009611 response to wounding Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0010469 regulation of signaling receptor activity Biological Process

GO:0019722 calcium-mediated signaling Biological Process

GO:0030308 negative regulation of cell growth Biological Process

GO:0040008 regulation of growth Biological Process

GO:0045926 negative regulation of growth Biological Process

GO:0048364 root development Biological Process

GO:0080092 regulation of pollen tube growth Biological Process

GO:0005576 extracellular region Cellular Component

KEGG gene cross-reference

ath:AT1G02900

ath:AT2G33775

ath:AT3G16570

ath:AT4G15800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.895

Rank 1 · LXL04_028987 · OH-1004

Cell membrane0.056

Rank 2 · LXL04_028987 · OH-1004

Endoplasmic reticulum0.049

Rank 3 · LXL04_028987 · OH-1004

Cytoplasm0.027

Rank 4 · LXL04_028987 · OH-1004

Golgi apparatus0.021

Rank 5 · LXL04_028987 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05498.17RALF72-115 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_028987	`PF05498.17`	RALF	72	115	1.7e-17	64.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L9P8`	Arabidopsis thaliana	Protein RALF-like 33	45.763%	Swiss-Prot	moderate database homology
`Q9SRY3`	Arabidopsis thaliana	Protein RALF-like 1	49.541%	Swiss-Prot	moderate database homology
`Q9LUS7`	Arabidopsis thaliana	Rapid alkalinization factor 23	42.754%	Swiss-Prot	moderate database homology
`Q6NME6`	Arabidopsis thaliana	Protein RALF-like 19	52.941%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card