LXL04_028697 | RubberDandelionOmics

Gene overview

LXL04_028697

Reference: OH-1004 Chr: Chr06 Coordinates: 55428957-55433333 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1989 bp · LXL04_028697|LXL04_028697|OH1004|cDNA

ATGCTCAAAGACTTAATTTTATCACATTTGTTTTTTCTTATTAAGCTGGAACCCTCGTACAATCTGCAAAACCTTGAGGCAGATGAGAAACTATGTCGTCTTAGAGAACACGCTTCTCTAATTTACATTGTTATACAATCATCAGCCATGGAATTTTATGCAACCAATCCGGGACCTATTGACGATTCTGTATTGTATGATCAAGAAAAGCATGTTTCATCAGCTGTTTGGGAGGGCCAGGAGCGTGGTGCACTTAGATG...

CDS

Download CDS FASTA

1989 bp · LXL04_028697|LXL04_028697|OH1004|CDS

ATGCTCAAAGACTTAATTTTATCACATTTGTTTTTTCTTATTAAGCTGGAACCCTCGTACAATCTGCAAAACCTTGAGGCAGATGAGAAACTATGTCGTCTTAGAGAACACGCTTCTCTAATTTACATTGTTATACAATCATCAGCCATGGAATTTTATGCAACCAATCCGGGACCTATTGACGATTCTGTATTGTATGATCAAGAAAAGCATGTTTCATCAGCTGTTTGGGAGGGCCAGGAGCGTGGTGCACTTAGATG...

Protein

Download Protein FASTA

662 aa · LXL04_028697|LXL04_028697|OH1004|PROTEIN

MLKDLILSHLFFLIKLEPSYNLQNLEADEKLCRLREHASLIYIVIQSSAMEFYATNPGPIDDSVLYDQEKHVSSAVWEGQERGALRCHEHTSKLDQWTLTPNQIELVKKSGFGYLRLIPAISLDNPLISALVERWRRETNTFHFTVGEMSVTLEDVGYLLGLPIDGDPVIGVTYTTCEAACIKYLGRAPDSGSTSGGMVKLSWLKETFARCPEGAPLDVIERHTRAYLLYLVGSTVFSTTTGNKVPVMYLPLFENFDQAG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_028697`
TK1151 ID	TkA07G189630
OH-1004 ID	LXL04_028697
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 92.598 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_028697

Location Chr06:55428957-55433333 (-)

Description Similar to At2g04865: Protein MAIN-LIKE 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g04865`	Maybe required to maintain cell division activity in meristematic cells.	No verified direct reference in this release
`At2g25010`	Acts as an important factor for cell fate determination and maintenance throughout plant development.	MAIN-LIKE1 is a crucial factor for correct cell division and differentiation in Arabidopsis thaliana.2014 · DOI: 10.1111/tpj.12455
`At1g17930`	Required for the organization of the root apical meristem (RAM) and the shoot apical meristem (SAM).	Identification of MAIN, a factor involved in genome stability in the meristems of Arabidopsis thaliana.2013 · DOI: 10.1111/tpj.12215
`At1g48120`	Maybe required to maintain cell division activity in meristematic cells.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028697 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0010073 meristem maintenance Biological Process

GO:0010082 regulation of root meristem growth Biological Process

GO:0048507 meristem development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0004722 protein serine/threonine phosphatase activity Molecular Function

GO:0008483 transaminase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G17930

ath:AT1G48120

ath:AT2G04865

ath:AT2G25010

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.932

Rank 1 · LXL04_028697 · OH-1004

Cytoplasm0.128

Rank 2 · LXL04_028697 · OH-1004

Cell membrane0.032

Rank 3 · LXL04_028697 · OH-1004

Endoplasmic reticulum0.018

Rank 4 · LXL04_028697 · OH-1004

Mitochondrion0.013

Rank 5 · LXL04_028697 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29561.1DUF856698-295 aa

PF10536.15PMD111-460 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_028697	`PF29561.1`	DUF8566	98	295	1.5e-20	74.6
LXL04_028697	`PF10536.15`	PMD	111	460	8.1e-110	368.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IFD0`	Arabidopsis thaliana	Protein MAIN-LIKE 2	60.611%	Swiss-Prot	strong database homology
`Q9SK32`	Arabidopsis thaliana	Protein MAIN-LIKE 1	52.814%	Swiss-Prot	moderate database homology
`Q9LMT7`	Arabidopsis thaliana	Protein MAINTENANCE OF MERISTEMS	49.330%	Swiss-Prot	moderate database homology
`Q9LNG5`	Arabidopsis thaliana	Serine/threonine-protein phosphatase 7 long form homolog	34.211%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card