Gene Card
Gene overview
cDNA / CDS / Protein Sequences
684 bp · LXL04_028656|LXL04_028656|OH1004|cDNA
ATGAAGGAGTTCAAAAGACCGGCGCTTCCTTGGCTGATCTCGCTGGACACAACGATGGAGAAAGGAACAGAGAAAGAAGGCTTACCGGACAGCAATGGAGGTGGTGGTCGCCGATCTGCAGCCAACCCAGCAAAGAAGAGGTTGCCGGCGGGAGCACTTCTTGGCAGCGGACTGTGTTCGGAGCTCATGAGGAGGGTAGCCTCCCGCTTGACCGATTTATCGGAGTCGGAGGAAGATCTCTCATCCGATCATCCTGAACA...
684 bp · LXL04_028656|LXL04_028656|OH1004|CDS
ATGAAGGAGTTCAAAAGACCGGCGCTTCCTTGGCTGATCTCGCTGGACACAACGATGGAGAAAGGAACAGAGAAAGAAGGCTTACCGGACAGCAATGGAGGTGGTGGTCGCCGATCTGCAGCCAACCCAGCAAAGAAGAGGTTGCCGGCGGGAGCACTTCTTGGCAGCGGACTGTGTTCGGAGCTCATGAGGAGGGTAGCCTCCCGCTTGACCGATTTATCGGAGTCGGAGGAAGATCTCTCATCCGATCATCCTGAACA...
Protein
Download Protein FASTA227 aa · LXL04_028656|LXL04_028656|OH1004|PROTEIN
MKEFKRPALPWLISLDTTMEKGTEKEGLPDSNGGGGRRSAANPAKKRLPAGALLGSGLCSELMRRVASRLTDLSESEEDLSSDHPEHEGAALDSWLCRTKRKALFVALDKIKEENRKRTYSDCYLRCDHGGIAQGLMSSIQILSFFRYAAPRARSEKTKWAVVMSEFAPIFIYLVISPLVSLIPLGVPFTFASNSSNYPEKLSAYECGFDHFGDVYITCRLFLIRLE
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_028656 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_028656 |
|---|---|
| Location | Chr06:52278807-52284000 (-) |
| Description | Similar to NAD3: NADH-ubiquinone oxidoreductase chain 3 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0022904 respiratory electron transport chain Biological Process GO:0030964 NADH dehydrogenase complex Cellular Component GO:0031966 mitochondrial membrane Cellular Component GO:0008137 NADH dehydrogenase (ubiquinone) activity Molecular Function GO:0016651 oxidoreductase activity, acting on NAD(P)H Molecular Function |
| KEGG gene cross-reference | rsz:13630152 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.