LXL04_028554 | RubberDandelionOmics

Gene overview

LXL04_028554

Reference: OH-1004 Chr: Chr06 Coordinates: 45554420-45557153 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1404 bp · LXL04_028554|LXL04_028554|OH1004|cDNA

ATGGAGGAGATGCTTCCGTCGGTGCCATTAAGCGTACGTAATCCAATCTGTAGCAAAACCCTCGTAGTAATCACTGGGATACAACAACAACAGCAATTCATGGCGGATAAAATCAATTTCGACGATTGTAACAATCATTCACAAGATTTGAATTCGGATTCTGGGTTTCAAGAAAGCGAGGATGAATTGATGTCATTAGAAGGCGATCCTGATCGCATCTTTGAAACCTCATGTACGCTATCTGTAGTGAGCGATTCAAG...

CDS

Download CDS FASTA

1404 bp · LXL04_028554|LXL04_028554|OH1004|CDS

ATGGAGGAGATGCTTCCGTCGGTGCCATTAAGCGTACGTAATCCAATCTGTAGCAAAACCCTCGTAGTAATCACTGGGATACAACAACAACAGCAATTCATGGCGGATAAAATCAATTTCGACGATTGTAACAATCATTCACAAGATTTGAATTCGGATTCTGGGTTTCAAGAAAGCGAGGATGAATTGATGTCATTAGAAGGCGATCCTGATCGCATCTTTGAAACCTCATGTACGCTATCTGTAGTGAGCGATTCAAG...

Protein

Download Protein FASTA

467 aa · LXL04_028554|LXL04_028554|OH1004|PROTEIN

MEEMLPSVPLSVRNPICSKTLVVITGIQQQQQFMADKINFDDCNNHSQDLNSDSGFQESEDELMSLEGDPDRIFETSCTLSVVSDSSSLCNEDFIAFESLNTLQEDGEKGVCLGDVATTGIVDDVATTEIVVSEKVSSVSRSVFEVDCVALWGFTSICGRRPEMEDAVATVPRFLKIPVQMLTGDKMTKSLSHLTAHFFGVYDGHGGSQVANYCSGRVHTALQEELEPLMAAGGGDESTTNNENSCQDLWKKAFIRCFLR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_028554`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_028554

Location Chr06:45554420-45557153 (+)

Description Similar to HAB1: Protein phosphatase 2C 16

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g72770`	Key component and repressor of the abscisic acid (ABA) signaling pathway that regulates numerous ABA responses, such as stomatal closure, seed germination and inhibition of vegetative growth.	Gain-of-function and loss-of-function phenotypes of the protein phosphatase 2C HAB1 reveal its role as a negative regulator of abscisic acid signalling.2004 · DOI: 10.1046/j.1365-313x.2003.01966.x Enhancement of abscisic acid sensitivity and reduction of water consumption in Arabidopsis by combined inactivation of the protein phosphatases type 2C ABI1 and HAB1.2006 · DOI: 10.1104/pp.106.081018 A hypermorphic mutation in the protein phosphatase 2C HAB1 strongly affects ABA signaling in Arabidopsis.2006 · DOI: 10.1016/j.febslet.2006.07.047
`At1g17550`	Key component and repressor of the abscisic acid (ABA) signaling pathway that regulates numerous ABA responses, such as stomatal closure, seed germination and inhibition of vegetative growth.	No verified direct reference in this release
`At4g26080`	Key component and repressor of the abscisic acid (ABA) signaling pathway that regulates numerous ABA responses, such as stomatal closure, osmotic water permeability of the plasma membrane (Pos), drought-induced resistance and rhizogenesis, response to glucose, high light stress, seed germination and inhibition of vegetative growth.	Arabidopsis abi1-1 and abi2-1 phosphatase mutations reduce abscisic acid-induced cytoplasmic calcium rises in guard cells.1999 · DOI: 10.1105/tpc.11.9.1785 ABI1 protein phosphatase 2C is a negative regulator of abscisic acid signaling.1999 · DOI: 10.1105/tpc.11.10.1897 The role of ABI1 in abscisic acid signal transduction: from gene to cell.1998 · PMID: 10645425 The genes ABI1 and ABI2 are involved in abscisic acid- and drought-inducible expression of the Daucus carota L. Dc3 promoter in guard cells of transgenic Arabidopsis thaliana (L.) Heynh.2000 · DOI: 10.1007/s004250050692 Analysis of Arabidopsis glucose insensitive mutants, gin5 and gin6, reveals a central role of the plant hormone ABA in the regulation of plant vegetative development by sugar.2000 · PMID: 10950871 The ABI1 and ABI2 protein phosphatases 2C act in a negative feedback regulatory loop of the abscisic acid signalling pathway.2001 · DOI: 10.1046/j.1365-313x.2001.00965.x Cortical actin filaments in guard cells respond differently to abscisic acid in wild-type and abi1-1 mutant Arabidopsis.2001 · DOI: 10.1007/s004250000489 Dissection of abscisic acid signal transduction pathways in barley aleurone layers.2001 · DOI: 10.1023/a:1011667312754 Abscisic acid activation of plasma membrane Ca(2+) channels in guard cells requires cytosolic NAD(P)H and is differentially disrupted upstream and downstream of reactive oxygen species production in abi1-1 and abi2-1 protein phosphatase 2C mutants.2001 · DOI: 10.1105/tpc.010210 The role of ABA and the transpiration stream in the regulation of the osmotic water permeability of leaf cells.2001 · DOI: 10.1073/pnas.231471998 Use of infrared thermal imaging to isolate Arabidopsis mutants defective in stomatal regulation.2002 · DOI: 10.1046/j.1365-313x.2002.01322.x Homeodomain protein ATHB6 is a target of the protein phosphatase ABI1 and regulates hormone responses in Arabidopsis.2002 · DOI: 10.1093/emboj/cdf316 A calcium sensor and its interacting protein kinase are global regulators of abscisic acid signaling in Arabidopsis.2002 · DOI: 10.1016/s1534-5807(02)00229-0 Role of Abscisic Acid in Drought-Induced Freezing Tolerance, Cold Acclimation, and Accumulation of LT178 and RAB18 Proteins in Arabidopsis thaliana.1995 · DOI: 10.1104/pp.107.1.141 Drought Rhizogenesis in Arabidopsis thaliana (Differential Responses of Hormonal Mutants).1994 · DOI: 10.1104/pp.104.2.761 Maternal Effects Govern Variable Dominance of Two Abscisic Acid Response Mutations in Arabidopsis thaliana.1994 · DOI: 10.1104/pp.105.4.1203 Genome-wide gene expression profiling in Arabidopsis thaliana reveals new targets of abscisic acid and largely impaired gene regulation in the abi1-1 mutant.2002 · DOI: 10.1242/jcs.00175 Control of Ascorbate Peroxidase 2 expression by hydrogen peroxide and leaf water status during excess light stress reveals a functional organisation of Arabidopsis leaves.2003 · DOI: 10.1046/j.1365-313x.2003.01656.x The abi1-1 mutation blocks ABA signaling downstream of cADPR action.2003 · DOI: 10.1046/j.1365-313x.2003.01721.x Synthesis of the Arabidopsis bifunctional lysine-ketoglutarate reductase/saccharopine dehydrogenase enzyme of lysine catabolism is concertedly regulated by metabolic and stress-associated signals.2003 · DOI: 10.1104/pp.103.026294 Regulation of the ABA-sensitive Arabidopsis potassium channel gene GORK in response to water stress.2003 · DOI: 10.1016/s0014-5793(03)01118-9 Phospholipase D alpha 1-derived phosphatidic acid interacts with ABI1 phosphatase 2C and regulates abscisic acid signaling.2004 · DOI: 10.1073/pnas.0402112101 Generation of active pools of abscisic acid revealed by in vivo imaging of water-stressed Arabidopsis.2005 · DOI: 10.1104/pp.104.053082 Heat stress phenotypes of Arabidopsis mutants implicate multiple signaling pathways in the acquisition of thermotolerance.2005 · DOI: 10.1104/pp.105.062257 Role of abscisic acid (ABA) and Arabidopsis thaliana ABA-insensitive loci in low water potential-induced ABA and proline accumulation.2006 · DOI: 10.1093/jxb/erj026 The regulatory domain of SRK2E/OST1/SnRK2.6 interacts with ABI1 and integrates abscisic acid (ABA) and osmotic stress signals controlling stomatal closure in Arabidopsis.2006 · DOI: 10.1074/jbc.m509820200 Fibrillin expression is regulated by abscisic acid response regulators and is involved in abscisic acid-mediated photoprotection.2006 · DOI: 10.1073/pnas.0501720103 A bifurcating pathway directs abscisic acid effects on stomatal closure and opening in Arabidopsis.2006 · DOI: 10.1126/science.1123769 Abscisic Acid Elicits the Water-Stress Response in Root Hairs of Arabidopsis thaliana.1992 · DOI: 10.1104/pp.100.1.216 Enhancement of abscisic acid sensitivity and reduction of water consumption in Arabidopsis by combined inactivation of the protein phosphatases type 2C ABI1 and HAB1.2006 · DOI: 10.1104/pp.106.081018 Abscisic acid antagonizes ethylene-induced hyponastic growth in Arabidopsis.2007 · DOI: 10.1104/pp.106.092700 Pseudomonas syringae pv. tomato hijacks the Arabidopsis abscisic acid signalling pathway to cause disease.2007 · DOI: 10.1038/sj.emboj.7601575 Nuclear localization of the mutant protein phosphatase abi1 is required for insensitivity towards ABA responses in Arabidopsis.2008 · DOI: 10.1111/j.1365-313x.2008.03454.x Cold acclimation and cold-regulated gene expression in ABA mutants of Arabidopsis thaliana.1991 · DOI: 10.1007/bf00028738 ABI1 and PP2CA phosphatases are negative regulators of Snf1-related protein kinase1 signaling in Arabidopsis.2013 · DOI: 10.1105/tpc.113.114066 Arabidopsis ABA-Activated Kinase MAPKKK18 is Regulated by Protein Phosphatase 2C ABI1 and the Ubiquitin-Proteasome Pathway.2015 · DOI: 10.1093/pcp/pcv146 AIK1, A Mitogen-Activated Protein Kinase, Modulates Abscisic Acid Responses through the MKK5-MPK6 Kinase Cascade.2017 · DOI: 10.1104/pp.16.01386 Sensitivity to abscisic acid of guard-cell K+ channels is suppressed by abi1-1, a mutant Arabidopsis gene encoding a putative protein phosphatase.1995 · DOI: 10.1073/pnas.92.21.9520 Abscisic acid-insensitive mutations provide evidence for stage-specific signal pathways regulating expression of an Arabidopsis late embryogenesis-abundant (lea) gene.1993 · DOI: 10.1007/bf00291999 The Arabidopsis homeobox gene ATHB-7 is induced by water deficit and by abscisic acid.1996 · DOI: 10.1046/j.1365-313x.1996.10020375.x Protein phosphatase activity of abscisic acid insensitive 1 (ABI1) protein from Arabidopsis thaliana.1996 · DOI: 10.1111/j.1432-1033.1996.0193t.x Differential abscisic acid regulation of guard cell slow anion channels in Arabidopsis wild-type and abi1 and abi2 mutants.1997 · DOI: 10.1105/tpc.9.3.409 Abscisic acid-independent and abscisic acid-dependent regulation of proline biosynthesis following cold and osmotic stresses in Arabidopsis thaliana.1997 · DOI: 10.1007/s004380050397 Interactions between the ABI1 and the ectopically expressed ABI3 genes in controlling abscisic acid responses in Arabidopsis vegetative tissues.1997 · DOI: 10.1046/j.1365-313x.1997.11040693.x The Arabidopsis ABSCISIC ACID-INSENSITIVE2 (ABI2) and ABI1 genes encode homologous protein phosphatases 2C involved in abscisic acid signal transduction.1997 · DOI: 10.1105/tpc.9.5.759 Alteration of anion channel kinetics in wild-type and abi1-1 transgenic Nicotiana benthamiana guard cells by abscisic acid.1997 · DOI: 10.1046/j.1365-313x.1997.12010203.x Convergence of the abscisic acid, CO2, and extracellular calcium signal transduction pathways in stomatal guard cells.1997 · DOI: 10.1104/pp.114.4.1557 Differential expression of two P5CS genes controlling proline accumulation during salt-stress requires ABA and is regulated by ABA1, ABI1 and AXR2 in Arabidopsis.1997 · DOI: 10.1046/j.1365-313x.1997.00557.x Mutational analysis of protein phosphatase 2C involved in abscisic acid signal transduction in higher plants.1998 · DOI: 10.1073/pnas.95.3.975

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0583100`	Probable protein phosphatase that may function in abscisic acid (ABA) signaling.	No verified direct reference in this release
`Os05g0592800`	Protein phosphatase that acts as a negative regulator of abscisic acid (ABA) signaling.	ABA Regulates Subcellular Redistribution of OsABI-LIKE2, a Negative Regulator in ABA Signaling, to Control Root Architecture and Drought Resistance in Oryza sativa.2015 · DOI: 10.1093/pcp/pcv154

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028554 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006470 protein dephosphorylation Biological Process

GO:0009408 response to heat Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009787 regulation of abscisic acid-activated signaling pathway Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0048364 root development Biological Process

GO:1902531 regulation of intracellular signal transduction Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G17550

ath:AT1G72770

ath:AT4G26080

dosa:Os01g0583100

dosa:Os05g0592800

osa:4339797

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.593

Rank 1 · LXL04_028554 · OH-1004

Cytoplasm0.392

Rank 2 · LXL04_028554 · OH-1004

Cell membrane0.117

Rank 3 · LXL04_028554 · OH-1004

Endoplasmic reticulum0.052

Rank 4 · LXL04_028554 · OH-1004

Lysosome / Vacuole0.041

Rank 5 · LXL04_028554 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00481.27PP2C181-450 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_028554	`PF00481.27`	PP2C	181	450	1.5e-63	215.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9CAJ0`	Arabidopsis thaliana	Protein phosphatase 2C 16	52.224%	Swiss-Prot	strong database homology
`Q9LNP9`	Arabidopsis thaliana	Protein phosphatase 2C 7	63.435%	Swiss-Prot	strong database homology
`P49597`	Arabidopsis thaliana	Protein phosphatase 2C 56	53.125%	Swiss-Prot	strong database homology
`Q0JLP9`	Oryza sativa subsp. japonica	Probable protein phosphatase 2C 6	66.382%	Swiss-Prot	strong database homology
`Q6L4R7`	Oryza sativa subsp. japonica	Protein phosphatase 2C 53	60.354%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card