LXL04_028550 | RubberDandelionOmics

Gene overview

LXL04_028550

Reference: OH-1004 Chr: Chr06 Coordinates: 45370016-45372764 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1149 bp · LXL04_028550|LXL04_028550|OH1004|cDNA

ATGAGCAACTTAGTGCAGGTACCCTACGACGCCACAGTGAAGCTGATGCTCGCTTCCCTCGAACGCAATCTGCTTCCAGACGCAGTTATCCGCAAGCTCACTCGTCTCCTTCTAGCCGGCCGTCTTCGTGCCTGCTTCAAACCCACATCTCAAGAACAACTCCAAGACCTTATGGCTTTCGTTCATTCACTAAAAGAAATGCCAATAGCTGTGAAGACGGAAGATGCCAAAACTCAACATTATGAGCTACCTACCTCTTT...

CDS

Download CDS FASTA

1149 bp · LXL04_028550|LXL04_028550|OH1004|CDS

ATGAGCAACTTAGTGCAGGTACCCTACGACGCCACAGTGAAGCTGATGCTCGCTTCCCTCGAACGCAATCTGCTTCCAGACGCAGTTATCCGCAAGCTCACTCGTCTCCTTCTAGCCGGCCGTCTTCGTGCCTGCTTCAAACCCACATCTCAAGAACAACTCCAAGACCTTATGGCTTTCGTTCATTCACTAAAAGAAATGCCAATAGCTGTGAAGACGGAAGATGCCAAAACTCAACATTATGAGCTACCTACCTCTTT...

Protein

Download Protein FASTA

382 aa · LXL04_028550|LXL04_028550|OH1004|PROTEIN

MSNLVQVPYDATVKLMLASLERNLLPDAVIRKLTRLLLAGRLRACFKPTSQEQLQDLMAFVHSLKEMPIAVKTEDAKTQHYELPTSFFNLVLGKNFKYRQLNFKFYFKISTQIQHYTFNIGCIKIGCCYFRDKLSTLEDAEEAMLEVYCEKSQLKDGHTVLDVGCGWGSLSIYIAQKFPNCQVTGICNSVTQKAHIEDQCGKLGLQNVKVIVADISTFEMEGSYDRIFSIEMFEHMKNYRDLLKKISSWMKQDGFLFVHF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_028550`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_028550`
Location	Chr06:45370016-45372764 (+)
Description	Similar to (S)-coclaurine N-methyltransferase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_028550` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0002238 response to molecule of fungal origin Biological Process GO:0009611 response to wounding Biological Process GO:0032259 methylation Biological Process GO:1901012 (S)-reticuline biosynthetic process Biological Process GO:0005737 cytoplasm Cellular Component GO:0008168 methyltransferase activity Molecular Function GO:0030782 (S)-tetrahydroprotoberberine N-methyltransferase activity Molecular Function GO:0030794 (S)-coclaurine-N-methyltransferase activity Molecular Function
KEGG gene cross-reference	ag:AAU20766 ag:ACO90251 ag:AOR51553 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.290

Rank 1 · LXL04_028550 · OH-1004

Endoplasmic reticulum0.258

Rank 2 · LXL04_028550 · OH-1004

Cytoplasm0.210

Rank 3 · LXL04_028550 · OH-1004

Peroxisome0.160

Rank 4 · LXL04_028550 · OH-1004

Nucleus0.085

Rank 5 · LXL04_028550 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02353.27CMAS126-339 aa

PF13489.13Methyltransf_23154-262 aa

PF13847.13Methyltransf_31155-272 aa

PF05175.21MTS156-229 aa

PF02390.24Methyltransf_4158-215 aa

PF13649.13Methyltransf_25160-254 aa

PF08241.19Methyltransf_11161-258 aa

PF08242.19Methyltransf_12161-256 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_028550	`PF02353.27`	CMAS	126	339	5e-40	138.2
LXL04_028550	`PF13489.13`	Methyltransf_23	154	262	1.4e-13	51.7
LXL04_028550	`PF13847.13`	Methyltransf_31	155	272	2.8e-14	53.8
LXL04_028550	`PF05175.21`	MTS	156	229	3e-06	27.6
LXL04_028550	`PF02390.24`	Methyltransf_4	158	215	8e-07	29.4
LXL04_028550	`PF13649.13`	Methyltransf_25	160	254	4e-16	60.2
LXL04_028550	`PF08241.19`	Methyltransf_11	161	258	1.5e-13	51.9
LXL04_028550	`PF08242.19`	Methyltransf_12	161	256	2.3e-12	48.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card