LXL04_028456 | RubberDandelionOmics

Gene overview

LXL04_028456

Reference: OH-1004 Chr: Chr06 Coordinates: 42364262-42367565 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

873 bp · LXL04_028456|LXL04_028456|OH1004|cDNA

ATGGAGAAGAGATATCCGGTTGCAACTGGTGGAATCCTCCACAAAATCAAGAAAGCTGCTTGCCTTGATGCATCGTCGTCAGATACTGGAAAGGGAAAAAGCAAGTCGTCTGATAACCAAGTGTCCCATGGATTTCACTTGGTGGAAGGGCGATCTGGGCATGACATGGAAGATTACCACGTGGCAGAATATAGAAACATAAAAGGCCATGTGCTCGGACTATTTGCCATTTTTGATGGCCATCTTGGTGATCGTGTACC...

CDS

Download CDS FASTA

873 bp · LXL04_028456|LXL04_028456|OH1004|CDS

ATGGAGAAGAGATATCCGGTTGCAACTGGTGGAATCCTCCACAAAATCAAGAAAGCTGCTTGCCTTGATGCATCGTCGTCAGATACTGGAAAGGGAAAAAGCAAGTCGTCTGATAACCAAGTGTCCCATGGATTTCACTTGGTGGAAGGGCGATCTGGGCATGACATGGAAGATTACCACGTGGCAGAATATAGAAACATAAAAGGCCATGTGCTCGGACTATTTGCCATTTTTGATGGCCATCTTGGTGATCGTGTACC...

Protein

Download Protein FASTA

290 aa · LXL04_028456|LXL04_028456|OH1004|PROTEIN

MEKRYPVATGGILHKIKKAACLDASSSDTGKGKSKSSDNQVSHGFHLVEGRSGHDMEDYHVAEYRNIKGHVLGLFAIFDGHLGDRVPSYLKDNLFNNILSEPSFWKDPKKAIKDAYRSTDQFILENAGQLGPGGSTAVTAIVIDGKDLWVANIGDSRAVLCERGSANQLTVDHEPHVERKRIEKQGGFVTNLPGDVPRVNGQLAVARAFGDQSLKAHLSSEPDIRHVPIDSTIELVILASDGLWKVMNNLEAIDMVKSVK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_028456`
TK1151 ID	TkA07G157520
OH-1004 ID	LXL04_028456
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_028456

Location Chr06:42364262-42367565 (+)

Description Similar to Os04g0609600: Probable protein phosphatase 2C 44

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g28400`	Probable protein phosphatase 2C 58.	No verified direct reference in this release
`At2g20630`	May be involved in defense signaling.	No verified direct reference in this release
`At1g22280`	Involved in the regulation of phytochrome signaling.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0609600`	Probable protein phosphatase 2C 44.	No verified direct reference in this release
`Os07g0507000`	Probable protein phosphatase 2C 62.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028456 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006470 protein dephosphorylation Biological Process

GO:0007165 signal transduction Biological Process

GO:0010161 red light signaling pathway Biological Process

GO:1902531 regulation of intracellular signal transduction Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0010494 cytoplasmic stress granule Cellular Component

GO:0004721 phosphoprotein phosphatase activity Molecular Function

GO:0004722 protein serine/threonine phosphatase activity Molecular Function

KEGG gene cross-reference

ath:AT1G22280

ath:AT2G20630

ath:AT4G28400

dosa:Os04g0609600

dosa:Os07g0507000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.414

Rank 1 · LXL04_028456 · OH-1004

Nucleus0.307

Rank 2 · LXL04_028456 · OH-1004

Cell membrane0.223

Rank 3 · LXL04_028456 · OH-1004

Endoplasmic reticulum0.099

Rank 4 · LXL04_028456 · OH-1004

Lysosome / Vacuole0.093

Rank 5 · LXL04_028456 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00481.27PP2C54-282 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_028456	`PF00481.27`	PP2C	54	282	9.3e-55	186.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93YW5`	Arabidopsis thaliana	Probable protein phosphatase 2C 58	62.544%	Swiss-Prot	strong database homology
`Q9SIU8`	Arabidopsis thaliana	Probable protein phosphatase 2C 20	61.151%	Swiss-Prot	strong database homology
`Q9LME4`	Arabidopsis thaliana	Probable protein phosphatase 2C 9	61.508%	Swiss-Prot	strong database homology
`Q0JAA0`	Oryza sativa subsp. japonica	Probable protein phosphatase 2C 44	80.357%	Swiss-Prot	strong database homology
`Q0D673`	Oryza sativa subsp. japonica	Probable protein phosphatase 2C 62	61.484%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card