LXL04_028312 | RubberDandelionOmics

Gene overview

LXL04_028312

Reference: OH-1004 Chr: Chr06 Coordinates: 37335921-37341040 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1437 bp · LXL04_028312|LXL04_028312|OH1004|cDNA

ATGGAGCACAATTGCATTGTTTCCTTTATGCTCTTCGTTGCGATAATTTGTATTTATTGCAGAGTTGAGTGTGTGAAAGCGTCTATAGTAACACAAGAAGTATATTCTAAACGCAGTTTTAGACCAAATATAGATACATCTACTCGCAGGAGAAAACTTATTCAAAAGCAAGCTGGAAGTGTTCGGCAAGATGTATGTGCAGGGACAAAAGGGAGAATGCCCAAAACACAGAAAAGTCCATGCCGCAAATTAGTAGTATG...

CDS

Download CDS FASTA

1437 bp · LXL04_028312|LXL04_028312|OH1004|CDS

ATGGAGCACAATTGCATTGTTTCCTTTATGCTCTTCGTTGCGATAATTTGTATTTATTGCAGAGTTGAGTGTGTGAAAGCGTCTATAGTAACACAAGAAGTATATTCTAAACGCAGTTTTAGACCAAATATAGATACATCTACTCGCAGGAGAAAACTTATTCAAAAGCAAGCTGGAAGTGTTCGGCAAGATGTATGTGCAGGGACAAAAGGGAGAATGCCCAAAACACAGAAAAGTCCATGCCGCAAATTAGTAGTATG...

Protein

Download Protein FASTA

478 aa · LXL04_028312|LXL04_028312|OH1004|PROTEIN

MEHNCIVSFMLFVAIICIYCRVECVKASIVTQEVYSKRSFRPNIDTSTRRRKLIQKQAGSVRQDVCAGTKGRMPKTQKSPCRKLVVWVPKKDGFIEFVNVNDQSKAIDGFSIAIFCHALQLLPYNVQPIFKPFINESGKSNGSYNDLLEHIEGQACQAAAGDITIRGNRAQHVDFTIPYLNSEVYVLVHGSHKWNEKLWNLLRPFTWGLWVTIVAACLFTGVALGILEYRAANPKFSGPIYTQLIMVIWFPIATFFFQEG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_028312`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_028312

Location Chr06:37335921-37341040 (-)

Description Similar to GLR3.1: Glutamate receptor 3.1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g17260`	Glutamate-gated receptor that probably acts as a non- selective cation channel.	De-regulated expression of the plant glutamate receptor homolog AtGLR3.1 impairs long-term Ca2+-programmed stomatal closure.2009 · DOI: 10.1111/j.1365-313x.2009.03789.x
`At2g32400`	Glutamate-gated receptor that probably acts as a non-selective cation channel.	No verified direct reference in this release
`At1g05200`	Glutamate-gated receptor that probably acts as a non-selective cation channel, at least in hypocotyls (Probable).	AtGLR3.4, a glutamate receptor channel-like gene is sensitive to touch and cold.2005 · DOI: 10.1007/s00425-005-1551-3 Glutamate receptor subtypes evidenced by differences in desensitization and dependence on the GLR3.3 and GLR3.4 genes.2008 · DOI: 10.1104/pp.107.108134 Dual localization of plant glutamate receptor AtGLR3.4 to plastids and plasmamembrane.2011 · DOI: 10.1016/j.bbabio.2010.11.008 Interacting glutamate receptor-like proteins in Phloem regulate lateral root initiation in Arabidopsis.2013 · DOI: 10.1105/tpc.113.110668 Glutamate Receptor Homolog3.4 is Involved in Regulation of Seed Germination Under Salt Stress in Arabidopsis.2018 · DOI: 10.1093/pcp/pcy034
`At5g11180`	Glutamate-gated receptor that probably acts as a non-selective cation channel.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0585200`	Glutamate-gated receptor that probably acts as a non-selective cation channel.	A rice glutamate receptor-like gene is critical for the division and survival of individual cells in the root apical meristem.2006 · DOI: 10.1105/tpc.105.037713

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028312 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006816 calcium ion transport Biological Process

GO:0006874 intracellular calcium ion homeostasis Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009611 response to wounding Biological Process

GO:0010118 stomatal movement Biological Process

GO:0019722 calcium-mediated signaling Biological Process

GO:0070417 cellular response to cold Biological Process

GO:0071230 cellular response to amino acid stimulus Biological Process

GO:0071260 cellular response to mechanical stimulus Biological Process

GO:0071311 cellular response to acetate Biological Process

GO:1901701 cellular response to oxygen-containing compound Biological Process

GO:0005576 extracellular region Cellular Component

KEGG gene cross-reference

ath:AT1G05200

ath:AT2G17260

ath:AT2G32400

ath:AT5G11180

osa:124544569

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.770

Rank 1 · LXL04_028312 · OH-1004

Cytoplasm0.104

Rank 2 · LXL04_028312 · OH-1004

Endoplasmic reticulum0.079

Rank 3 · LXL04_028312 · OH-1004

Lysosome / Vacuole0.070

Rank 4 · LXL04_028312 · OH-1004

Extracellular0.043

Rank 5 · LXL04_028312 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00060.33Lig_chan207-450 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_028312	`PF00060.33`	Lig_chan	207	450	9.6e-17	61.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q7XJL2`	Arabidopsis thaliana	Glutamate receptor 3.1	35.396%	Swiss-Prot	moderate database homology
`Q9SDQ4`	Arabidopsis thaliana	Glutamate receptor 3.7	34.422%	Swiss-Prot	moderate database homology
`Q8GXJ4`	Arabidopsis thaliana	Glutamate receptor 3.4	31.973%	Swiss-Prot	moderate database homology
`Q9LFN8`	Arabidopsis thaliana	Glutamate receptor 2.6	31.678%	Swiss-Prot	moderate database homology
`Q7XP59`	Oryza sativa subsp. japonica	Glutamate receptor 3.1	34.606%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card