LXL04_028202 | RubberDandelionOmics

Gene overview

LXL04_028202

Reference: OH-1004 Chr: Chr06 Coordinates: 34327157-34329985 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2469 bp · LXL04_028202|LXL04_028202|OH1004|cDNA

ATGGCAACCTCATCAACCGCAACTCCTCCTTATATTTCATCACAAATACAAGACCTTAACTACCTGTACGCATCAATCGCCAACGTCTCCAACTTCGTTTCTGTAAAGCTTGCCAGTGACCGCAACTACCATCTTTGGAAGACCCAGATGGTTTGTCTCATGAAGACTCACAACATGGTCGGCCTCGTAGATGACACAATCGTGGGTCCCACAGCTTCAACCAATGAGATTATGGATCAATACGACAGCCTTCTTAAAGG...

CDS

Download CDS FASTA

2451 bp · LXL04_028202|LXL04_028202|OH1004|CDS

ATGGCAACCTCATCAACCGCAACTCCTCCTTATATTTCATCACAAATACAAGACCTTAACTACCTGTACGCATCAATCGCCAACGTCTCCAACTTCGTTTCTGTAAAGCTTGCCAGTGACCGCAACTACCATCTTTGGAAGACCCAGATGGTTTGTCTCATGAAGACTCACAACATGGTCGGCCTCGTAGATGACACAATCGTGGGTCCCACAGCTTCAACCAATGAGATTATGGATCAATACGACAGCCTTCTTAAAGG...

Protein

Download Protein FASTA

816 aa · LXL04_028202|LXL04_028202|OH1004|PROTEIN

MATSSTATPPYISSQIQDLNYLYASIANVSNFVSVKLASDRNYHLWKTQMVCLMKTHNMVGLVDDTIVGPTASTNEIMDQYDSLLKGWIFGSVTENVLAAVVDLLSAKDVWDNLKSFYDAPITSLNADRGGTKQEAKSETKDIDGITAEAKPDVKDTITIDVNETETETKTELEKLLGHTLKGNFYQAESILRKNKDTARVAIRDDGSTILHLAVALGHNDFVKELVSYIKDEDYVLERRSSDGSTALHIAAIVGNRYVA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_028202`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_028202

Location Chr06:34327157-34329985 (-)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g02620`	Ankyrin repeat-containing protein At5g02620.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028202 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0006654 phosphatidic acid biosynthetic process Biological Process

GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway Biological Process

GO:0031571 mitotic G1 DNA damage checkpoint signaling Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0046339 diacylglycerol metabolic process Biological Process

GO:0046486 glycerolipid metabolic process Biological Process

GO:0046580 negative regulation of Ras protein signal transduction Biological Process

GO:0046834 lipid phosphorylation Biological Process

GO:0050860 negative regulation of T cell receptor signaling pathway Biological Process

GO:0070682 proteasome regulatory particle assembly Biological Process

GO:0099562 maintenance of postsynaptic density structure Biological Process

KEGG gene cross-reference

ath:AT5G02620

ddi:DDB_G0287345

rno:81821

spo:2542919

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.858

Rank 1 · LXL04_028202 · OH-1004

Endoplasmic reticulum0.089

Rank 2 · LXL04_028202 · OH-1004

Cytoplasm0.071

Rank 3 · LXL04_028202 · OH-1004

Lysosome / Vacuole0.033

Rank 4 · LXL04_028202 · OH-1004

Nucleus0.031

Rank 5 · LXL04_028202 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14223.15Retrotran_gag_252-120 aa

PF12796.14Ank_2201-268 aa

PF12796.14Ank_2211-302 aa

PF13962.12PGG640-753 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_028202	`PF14223.15`	Retrotran_gag_2	52	120	4e-06	27.4
LXL04_028202	`PF12796.14`	Ank_2	201	268	4.5e-21	75.9
LXL04_028202	`PF12796.14`	Ank_2	211	302	4.5e-21	75.9
LXL04_028202	`PF13962.12`	PGG	640	753	5.1e-23	81.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6AWW5`	Arabidopsis thaliana	Ankyrin repeat-containing protein At5g02620	33.028%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card