LXL04_028147 | RubberDandelionOmics

Gene overview

LXL04_028147

Reference: OH-1004 Chr: Chr06 Coordinates: 32511538-32514361 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

588 bp · LXL04_028147|LXL04_028147|OH1004|cDNA

ATGCGAGGTGACGAGGCAAATAAATTTCCCCCCAGATTCATCCTGTTCAAGTTCATGTCCTCTGATGATAAAGCTGACTTAAACATTTGTTTCTATTCTTTCAAGAAAGGATGTGAGCGTGCATTAATTGCTGAGATGTATCTTGACCTCACTAAAGCTGCtgaaaaaatgatgaaagaaAGCTTGGAAAGCATCCATGAAGAAGTTCTTAAATCACATGTTTTAGGGCTTAATCTAAAGCTGATGCAACAAAAAGACGG...

CDS

Download CDS FASTA

588 bp · LXL04_028147|LXL04_028147|OH1004|CDS

ATGCGAGGTGACGAGGCAAATAAATTTCCCCCCAGATTCATCCTGTTCAAGTTCATGTCCTCTGATGATAAAGCTGACTTAAACATTTGTTTCTATTCTTTCAAGAAAGGATGTGAGCGTGCATTAATTGCTGAGATGTATCTTGACCTCACTAAAGCTGCTGAAAAAATGATGAAAGAAAGCTTGGAAAGCATCCATGAAGAAGTTCTTAAATCACATGTTTTAGGGCTTAATCTAAAGCTGATGCAACAAAAAGACGG...

Protein

Download Protein FASTA

195 aa · LXL04_028147|LXL04_028147|OH1004|PROTEIN

MRGDEANKFPPRFILFKFMSSDDKADLNICFYSFKKGCERALIAEMYLDLTKAAEKMMKESLESIHEEVLKSHVLGLNLKLMQQKDGDHRDKLDKPIGTVVKKLQGRGYSDETFRDDLSSATSLRPSELVNGGGHGGVAYVVVEGGGRHVEEGGGRLAEVGGGRLVEVGGGRRVQLVEKGGGLHDAVDYGGVVVI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_028147`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_028147

Location Chr06:32511538-32514361 (+)

Description Similar to POLH: DNA polymerase eta

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g44740`	Error-free DNA polymerase specifically involved in DNA repair.	Analysis of UV-induced mutation spectra in Escherichia coli by DNA polymerase eta from Arabidopsis thaliana.2006 · DOI: 10.1016/j.mrfmmm.2006.05.036 Two translesion synthesis DNA polymerase genes, AtPOLH and AtREV1, are involved in development and UV light resistance in Arabidopsis.2008 · DOI: 10.1016/j.jplph.2007.11.012 Arabidopsis thaliana Y-family DNA polymerase eta catalyses translesion synthesis and interacts functionally with PCNA2.2008 · DOI: 10.1111/j.1365-313x.2008.03562.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028147 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0009314 response to radiation Biological Process

GO:0009650 UV protection Biological Process

GO:0010224 response to UV-B Biological Process

GO:0042276 error-prone translesion synthesis Biological Process

GO:0005634 nucleus Cellular Component

GO:0005657 replication fork Cellular Component

GO:0035861 site of double-strand break Cellular Component

GO:0003684 damaged DNA binding Molecular Function

GO:0003887 DNA-directed DNA polymerase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT5G44740

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.460

Rank 1 · LXL04_028147 · OH-1004

Nucleus0.345

Rank 2 · LXL04_028147 · OH-1004

Mitochondrion0.125

Rank 3 · LXL04_028147 · OH-1004

Cell membrane0.121

Rank 4 · LXL04_028147 · OH-1004

Endoplasmic reticulum0.077

Rank 5 · LXL04_028147 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H2D5`	Arabidopsis thaliana	DNA polymerase eta	41.880%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card