LXL04_028136 | RubberDandelionOmics

Gene overview

LXL04_028136

Reference: OH-1004 Chr: Chr06 Coordinates: 32222139-32225508 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

707 bp · LXL04_028136|LXL04_028136|OH1004|cDNA

ATGGCTTCCATCAAGCCATACTCCCCACTCTCATCGCTATTAAACCAAACGATGCCTTCATTAAACCCATCGTTTTCCTTCAAACCCATCTCTGAATTCCCATTTCCATCACAATTCAGCCGTGAACGAGGACAAGTTTCAGTCTCTGTAGCATTCAATCCAAGTGGGAACTTCGACCTCTCATTGTATGATGAACAAGAAAATGTAGAACAAGCACCTCCACCCATGCCTCCAAAAGAAGGTAGATGTGAAGTCGTAAT...

CDS

Download CDS FASTA

552 bp · LXL04_028136|LXL04_028136|OH1004|CDS

ATGGCTTCCATCAAGCCATACTCCCCACTCTCATCGCTATTAAACCAAACGATGCCTTCATTAAACCCATCGTTTTCCTTCAAACCCATCTCTGAATTCCCATTTCCATCACAATTCAGCCGTGAACGAGGACAAGTTTCAGTCTCTGTAGCATTCAATCCAAGTGGGAACTTCGACCTCTCATTGTATGATGAACAAGAAAATGTAGAACAAGCACCTCCACCCATGCCTCCAAAAGAAGGTAGATGTGAAGTCGTAAT...

Protein

Download Protein FASTA

183 aa · LXL04_028136|LXL04_028136|OH1004|PROTEIN

MASIKPYSPLSSLLNQTMPSLNPSFSFKPISEFPFPSQFSRERGQVSVSVAFNPSGNFDLSLYDEQENVEQAPPPMPPKEGRCEVVIDNDTIRSLDLSPFSSGTGITTSSNVEPREFLERTIGFTINYHRDDEHDPRELSEFPDIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQVY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_028136`
TK1151 ID	TkA07G123310
OH-1004 ID	LXL04_028136
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	98.900
Protein coverage (%)	TK1151 72.691 / OH-1004 98.907 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_028136

Location Chr06:32222139-32225508 (+)

Description Similar to CRR6: Protein CHLORORESPIRATORY REDUCTION 6, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g47910`	Required for both formation and activity of the chloroplast NAD(P)H dehydrogenase (NDH) complex of the photosynthetic electron transport chain.	Chlororespiratory reduction 6 is a novel factor required for accumulation of the chloroplast NAD(P)H dehydrogenase complex in Arabidopsis.2006 · DOI: 10.1104/pp.106.080267

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028136 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0010275 NAD(P)H dehydrogenase complex assembly Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009570 chloroplast stroma Cellular Component

KEGG gene cross-reference

ath:AT2G47910

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.932

Rank 1 · LXL04_028136 · OH-1004

Nucleus0.086

Rank 2 · LXL04_028136 · OH-1004

Mitochondrion0.040

Rank 3 · LXL04_028136 · OH-1004

Cytoplasm0.039

Rank 4 · LXL04_028136 · OH-1004

Cell membrane0.025

Rank 5 · LXL04_028136 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08847.17Crr687-182 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_028136	`PF08847.17`	Crr6	87	182	4.2e-35	121.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82258`	Arabidopsis thaliana	Protein CHLORORESPIRATORY REDUCTION 6, chloroplastic	65.753%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card