LXL04_028088 | RubberDandelionOmics

Gene overview

LXL04_028088

Reference: OH-1004 Chr: Chr06 Coordinates: 30965645-30977422 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

843 bp · LXL04_028088|LXL04_028088|OH1004|cDNA

AGTTTACTCTATGAATAAATCTTGTAGGTGTACCACTCTAGAATTGTGGATTTGAAAGGAGTTAGTAAAGCTTGTGGATGTCCCCTACTTCCTCTTAAAAACCAAACAACAGGACATGCTCCTCGTCTTTCTGATCAAGGCGAAGATATTGTGGATGAAGCGATAAAGTTGTTTAGAGCAAATGTGTTCTTTAAACACTTTGATTTGAAAACCCCTTCTGATAGGATTCTTGTGTACTTaacattttatataaatatggC...

CDS

Download CDS FASTA

792 bp · LXL04_028088|LXL04_028088|OH1004|CDS

TTGAAAGGAGTTAGTAAAGCTTGTGGATGTCCCCTACTTCCTCTTAAAAACCAAACAACAGGACATGCTCCTCGTCTTTCTGATCAAGGCGAAGATATTGTGGATGAAGCGATAAAGTTGTTTAGAGCAAATGTGTTCTTTAAACACTTTGATTTGAAAACCCCTTCTGATAGGATTCTTGTGTACTTAACATTTTATATAAATATGGCATTGAAGAGGCTGGAAGGGTGCAGAACTTTGACTGAAGGGACAAAAGCCAT...

Protein

Download Protein FASTA

263 aa · LXL04_028088|LXL04_028088|OH1004|PROTEIN

MKGVSKACGCPLLPLKNQTTGHAPRLSDQGEDIVDEAIKLFRANVFFKHFDLKTPSDRILVYLTFYINMALKRLEGCRTLTEGTKAIKNLSMENVYVPGEPGFSFSKIFPPFGSNKEAEVIRDYFKHIREETNKRLLNVAYRANGTPNKWWLAFAKRFIAMFATPANQDVDCCLIPESPFYLEGQGGLFEFIQHRLKENGHVVIVVAEGAGQEYVSNAVNAIEEKDASGNKLLLDIGQWLTQKIKDHFEKVKKVPINMKY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_028088`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_028088

Location Chr06:30965645-30977422 (-)

Description Similar to PFK4: ATP-dependent 6-phosphofructokinase 4, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g60430`	Functions as a component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.	No verified direct reference in this release
`At5g61580`	Catalyzes the phosphorylation of D-fructose 6-phosphate to fructose 1,6-bisphosphate by ATP, the first committing step of glycolysis.	No verified direct reference in this release
`At4g26270`	Catalyzes the phosphorylation of D-fructose 6-phosphate to fructose 1,6-bisphosphate by ATP, the first committing step of glycolysis.	No verified direct reference in this release
`At4g32840`	Catalyzes the phosphorylation of D-fructose 6-phosphate to fructose 1,6-bisphosphate by ATP, the first committing step of glycolysis.	No verified direct reference in this release
`At5g56630`	Catalyzes the phosphorylation of D-fructose 6-phosphate to fructose 1,6-bisphosphate by ATP, the first committing step of glycolysis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028088 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006002 fructose 6-phosphate metabolic process Biological Process

GO:0006096 glycolytic process Biological Process

GO:0007015 actin filament organization Biological Process

GO:0010053 root epidermal cell differentiation Biological Process

GO:0030833 regulation of actin filament polymerization Biological Process

GO:0034314 Arp2/3 complex-mediated actin nucleation Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005885 Arp2/3 protein complex Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0042995 cell projection Cellular Component

KEGG gene cross-reference

ath:AT1G60430

ath:AT4G26270

ath:AT4G32840

ath:AT5G56630

ath:AT5G61580

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.313

Rank 1 · LXL04_028088 · OH-1004

Cytoplasm0.305

Rank 2 · LXL04_028088 · OH-1004

Peroxisome0.166

Rank 3 · LXL04_028088 · OH-1004

Nucleus0.139

Rank 4 · LXL04_028088 · OH-1004

Extracellular0.093

Rank 5 · LXL04_028088 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04062.20P21-Arc4-157 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_028088	`PF04062.20`	P21-Arc	4	157	6.2e-50	170.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q1ECJ7`	Arabidopsis thaliana	Actin-related protein 2/3 complex subunit 3	66.026%	Swiss-Prot	moderate database homology
`Q9FKG3`	Arabidopsis thaliana	ATP-dependent 6-phosphofructokinase 4, chloroplastic	74.038%	Swiss-Prot	weak database homology
`Q94AA4`	Arabidopsis thaliana	ATP-dependent 6-phosphofructokinase 3	55.147%	Swiss-Prot	weak database homology
`Q9M076`	Arabidopsis thaliana	ATP-dependent 6-phosphofructokinase 6	64.423%	Swiss-Prot	weak database homology
`Q9C5J7`	Arabidopsis thaliana	ATP-dependent 6-phosphofructokinase 7	54.745%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card