LXL04_028064 | RubberDandelionOmics

Gene overview

LXL04_028064

Reference: OH-1004 Chr: Chr06 Coordinates: 30205666-30206364 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

699 bp · LXL04_028064|LXL04_028064|OH1004|cDNA

ATGGAATATCTTAATCTAAACTTGGTGTTGTTGATATCCATGATGATCGCAACCATGTTCCTTCACGGCACGGAAGCCCAGACCAGACACATTGTCGGCGGCAGTTTCGGGTGGACAATTCCGTCCAGTGGAGCCGCTGCTTACACCAATTGGGCATCCCGTCAAACTTTCACCGTCGACGATCTTCTTGTCTTTACCTTCACTGATGGAGAACACGACGTTGCAGAGATCTCAGCGGCGGCGTTCGGCTCATGCACCGC...

CDS

Download CDS FASTA

699 bp · LXL04_028064|LXL04_028064|OH1004|CDS

ATGGAATATCTTAATCTAAACTTGGTGTTGTTGATATCCATGATGATCGCAACCATGTTCCTTCACGGCACGGAAGCCCAGACCAGACACATTGTCGGCGGCAGTTTCGGGTGGACAATTCCGTCCAGTGGAGCCGCTGCTTACACCAATTGGGCATCCCGTCAAACTTTCACCGTCGACGATCTTCTTGTCTTTACCTTCACTGATGGAGAACACGACGTTGCAGAGATCTCAGCGGCGGCGTTCGGCTCATGCACCGC...

Protein

Download Protein FASTA

232 aa · LXL04_028064|LXL04_028064|OH1004|PROTEIN

MEYLNLNLVLLISMMIATMFLHGTEAQTRHIVGGSFGWTIPSSGAAAYTNWASRQTFTVDDLLVFTFTDGEHDVAEISAAAFGSCTATNPISLATNGPATLTLTTPGTHYYICTFRSHCQIGQKLTINVSETASATPPPATPRAPVAVSPPTIKPPPPSVPPKTPVPPPDTTGSPPSPTPATPFAPCPRITPATSDQSSLPPTATELSGGARSFTTLVPSTLLIYGFIFLNY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_028064`
TK1151 ID	TkA07G117230
OH-1004 ID	LXL04_028064
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	89.800
Protein coverage (%)	TK1151 94.059 / OH-1004 84.914 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_028064

Location Chr06:30205666-30206364 (-)

Description Similar to UCC1: Uclacyanin 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g32300`	Uclacyanin 1.	No verified direct reference in this release
`At5g20230`	Probably acts as an electron carrier.	No verified direct reference in this release
`At2g25060`	May act as a carbohydrate transporter.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028064 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002239 response to oomycetes Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009646 response to absence of light Biological Process

GO:0015690 aluminum cation transport Biological Process

GO:0070417 cellular response to cold Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:1901141 regulation of lignin biosynthetic process Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

KEGG gene cross-reference

ath:AT2G25060

ath:AT2G32300

ath:AT5G20230

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.621

Rank 1 · LXL04_028064 · OH-1004

Extracellular0.179

Rank 2 · LXL04_028064 · OH-1004

Endoplasmic reticulum0.109

Rank 3 · LXL04_028064 · OH-1004

Cytoplasm0.066

Rank 4 · LXL04_028064 · OH-1004

Nucleus0.033

Rank 5 · LXL04_028064 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02298.24Cu_bind_like38-123 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_028064	`PF02298.24`	Cu_bind_like	38	123	3.8e-22	78.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82081`	Arabidopsis thaliana	Uclacyanin 1	37.423%	Swiss-Prot	moderate database homology
`Q07488`	Arabidopsis thaliana	Blue copper protein	43.697%	Swiss-Prot	moderate database homology
`Q9SK27`	Arabidopsis thaliana	Early nodulin-like protein 14	35.345%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card