LXL04_028014 | RubberDandelionOmics

Gene overview

LXL04_028014

Reference: OH-1004 Chr: Chr06 Coordinates: 28700203-28704933 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2637 bp · LXL04_028014|LXL04_028014|OH1004|cDNA

ATGGGGGAAAGCAGTCGGAAGTATGAAAACGTGAAAACTGCAGCCGAGATGTTACGGAATACACCGTCGAATATAAGGAGGTTAGCTGATGAGATACAGCAGTGTGAGGGAAGACAGAAGTATCTTGCGCAGACTAGAAGCCCCTCGGATGGGGGCGATGTTAGATGGTACTATTCTAAGCTTCCAGTGGCGGAAAACGAGCTAGCTGCTGCTGTCCCACCTACAGAAGTAGTAGGGAAAGGTGATTACTTCCGATTTGG...

CDS

Download CDS FASTA

2637 bp · LXL04_028014|LXL04_028014|OH1004|CDS

ATGGGGGAAAGCAGTCGGAAGTATGAAAACGTGAAAACTGCAGCCGAGATGTTACGGAATACACCGTCGAATATAAGGAGGTTAGCTGATGAGATACAGCAGTGTGAGGGAAGACAGAAGTATCTTGCGCAGACTAGAAGCCCCTCGGATGGGGGCGATGTTAGATGGTACTATTCTAAGCTTCCAGTGGCGGAAAACGAGCTAGCTGCTGCTGTCCCACCTACAGAAGTAGTAGGGAAAGGTGATTACTTCCGATTTGG...

Protein

Download Protein FASTA

878 aa · LXL04_028014|LXL04_028014|OH1004|PROTEIN

MGESSRKYENVKTAAEMLRNTPSNIRRLADEIQQCEGRQKYLAQTRSPSDGGDVRWYYSKLPVAENELAAAVPPTEVVGKGDYFRFGMRDSLAIEASFLQREEELLSNWWREYGECSEGPKGSLSSIPESDPDQKPYNAPTTQSSKLYTDEEERVGVPVKGGLYEVDLLRRHSFPVYWNGDNRRVLRGHWFAVKGSLDWLPLREDVAEQLEFAYRSKVWHRRTFQPSGLFAARVDMPGSSPGLHALFTGEDDTWEAWLYI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_028014`
TK1151 ID	TkA07G112790
OH-1004 ID	LXL04_028014
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_028014

Location Chr06:28700203-28704933 (-)

Description Similar to SGR2: Phospholipase SGR2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g31480`	Involved in vacuolar formation or function (e.g. formation of vacuolar membrane 'bulbs').	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028014 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001675 acrosome assembly Biological Process

GO:0007286 spermatid development Biological Process

GO:0007338 single fertilization Biological Process

GO:0009590 detection of gravity Biological Process

GO:0009630 gravitropism Biological Process

GO:0009660 amyloplast organization Biological Process

GO:0009959 negative gravitropism Biological Process

GO:0016042 lipid catabolic process Biological Process

GO:0019433 triglyceride catabolic process Biological Process

GO:0034389 lipid droplet organization Biological Process

GO:0046488 phosphatidylinositol metabolic process Biological Process

GO:0090141 positive regulation of mitochondrial fission Biological Process

KEGG gene cross-reference

ath:AT1G31480

bta:338047

hsa:23259

mmu:72108

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.493

Rank 1 · LXL04_028014 · OH-1004

Golgi apparatus0.230

Rank 2 · LXL04_028014 · OH-1004

Nucleus0.161

Rank 3 · LXL04_028014 · OH-1004

Cell membrane0.159

Rank 4 · LXL04_028014 · OH-1004

Mitochondrion0.131

Rank 5 · LXL04_028014 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02862.23DDHD619-757 aa

PF02862.23DDHD757-820 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_028014	`PF02862.23`	DDHD	619	757	2.2e-45	156.6
LXL04_028014	`PF02862.23`	DDHD	757	820	2.2e-45	156.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W5R2`	Arabidopsis thaliana	Phospholipase SGR2	58.881%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card