LXL04_027990 | RubberDandelionOmics

Gene overview

LXL04_027990

Reference: OH-1004 Chr: Chr06 Coordinates: 28236700-28238148 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

942 bp · LXL04_027990|LXL04_027990|OH1004|cDNA

ATGGTCTCTTCGCATATCCTCCCTCAGTTATCTTCCCTCCACAACCCTAAATTCTCCTTCAATTCCACCAGTTCAACACACACGCTAGCTTTCAACAATACCCTTTATAAACCCATCATCAAACCCCCCAATTTTCTTGGCTTTAGGTACTCTCCAAACCATAGAACTCACCTTCGCGAGCTAAGTTGCCATGGAACTAAAGACCCCGCTAAGGAATTGAAGGTTGGTTTGGATTTAGAAGGTggaggtggcggtggtgg...

CDS

Download CDS FASTA

942 bp · LXL04_027990|LXL04_027990|OH1004|CDS

ATGGTCTCTTCGCATATCCTCCCTCAGTTATCTTCCCTCCACAACCCTAAATTCTCCTTCAATTCCACCAGTTCAACACACACGCTAGCTTTCAACAATACCCTTTATAAACCCATCATCAAACCCCCCAATTTTCTTGGCTTTAGGTACTCTCCAAACCATAGAACTCACCTTCGCGAGCTAAGTTGCCATGGAACTAAAGACCCCGCTAAGGAATTGAAGGTTGGTTTGGATTTAGAAGGTGGAGGTGGCGGTGGTGG...

Protein

Download Protein FASTA

313 aa · LXL04_027990|LXL04_027990|OH1004|PROTEIN

MVSSHILPQLSSLHNPKFSFNSTSSTHTLAFNNTLYKPIIKPPNFLGFRYSPNHRTHLRELSCHGTKDPAKELKVGLDLEGGGGGGGGDGGGDGGDGNEEKKGGFLPDWVDFTSDDAKTVFAALAVSLAFRSFIAEPRFIPSLSMYPTFDVGDRLVAEKVSYYFRKPCPNDIVIFKSPPVLQEVGYTDDDVFIKRVVAKAGDLVEVHDGKLIVNGVPRNEDFTLEAPKYEMNPVRVPENSVFVMGDNRNNSYDSHVWGPL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027990`
TK1151 ID	TkA07G111010
OH-1004 ID	LXL04_027990
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027990

Location Chr06:28236700-28238148 (-)

Description Similar to PLSP1: Chloroplast processing peptidase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g24590`	Involved in the maturation of the plastid protein translocation channel.	No verified direct reference in this release
`At2g30440`	Cleaves the thylakoid-transfer domain from a chloroplast protein.	No verified direct reference in this release
`At1g06870`	Cleaves the thylakoid-transfer domain from a chloroplast protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027990 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006465 signal peptide processing Biological Process

GO:0010027 thylakoid membrane organization Biological Process

GO:0051604 protein maturation Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009526 plastid envelope Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0055035 plastid thylakoid membrane Cellular Component

GO:0004175 endopeptidase activity Molecular Function

GO:0004252 serine-type endopeptidase activity Molecular Function

KEGG gene cross-reference

ath:AT1G06870

ath:AT2G30440

ath:AT3G24590

syn:sll0716

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.970

Rank 1 · LXL04_027990 · OH-1004

Mitochondrion0.031

Rank 2 · LXL04_027990 · OH-1004

Nucleus0.015

Rank 3 · LXL04_027990 · OH-1004

Cytoplasm0.012

Rank 4 · LXL04_027990 · OH-1004

Cell membrane0.012

Rank 5 · LXL04_027990 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10502.15Peptidase_S26117-274 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027990	`PF10502.15`	Peptidase_S26	117	274	1.6e-42	146.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H0W1`	Arabidopsis thaliana	Chloroplast processing peptidase	70.229%	Swiss-Prot	strong database homology
`O04348`	Arabidopsis thaliana	Thylakoidal processing peptidase 1, chloroplastic	54.839%	Swiss-Prot	moderate database homology
`Q9M9Z2`	Arabidopsis thaliana	Probable thylakoidal processing peptidase 2, chloroplastic	62.222%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card