LXL04_027965 | RubberDandelionOmics

Gene overview

LXL04_027965

Reference: OH-1004 Chr: Chr06 Coordinates: 27823373-27826261 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2889 bp · LXL04_027965|LXL04_027965|OH1004|cDNA

ATGGGTTTTCAGTTTTCTTCGCTTCTTTCCTTTCATGTTTCGATCCGTATTTCGTATCACTTAATCATATTCAGGTCGTTGAATTTTGCAAAAATCCTATCGATGGAATGGAATGATGAAACGTTACGCAATCTGACGCAATTTTTTGCAAACAAAGTCTCGACAAAAAAAGATATGAAACGCCGTGGTAAAAGAGAATTAACTGAAGCGGCAAAGAAGCCTAACTACGGCGTTTGTGTTCTCCGTCTCGTTGCTGAAGG...

CDS

Download CDS FASTA

2889 bp · LXL04_027965|LXL04_027965|OH1004|CDS

ATGGGTTTTCAGTTTTCTTCGCTTCTTTCCTTTCATGTTTCGATCCGTATTTCGTATCACTTAATCATATTCAGGTCGTTGAATTTTGCAAAAATCCTATCGATGGAATGGAATGATGAAACGTTACGCAATCTGACGCAATTTTTTGCAAACAAAGTCTCGACAAAAAAAGATATGAAACGCCGTGGTAAAAGAGAATTAACTGAAGCGGCAAAGAAGCCTAACTACGGCGTTTGTGTTCTCCGTCTCGTTGCTGAAGG...

Protein

Download Protein FASTA

962 aa · LXL04_027965|LXL04_027965|OH1004|PROTEIN

MGFQFSSLLSFHVSIRISYHLIIFRSLNFAKILSMEWNDETLRNLTQFFANKVSTKKDMKRRGKRELTEAAKKPNYGVCVLRLVAEGAVAENIRECAAVNFTNHLIRRWVPSSAAPITDGEKEEIKTLIVPLILSATPTIRNELSKALAVIGNDDFAMVWSVLLPEVKSNLDKALIQNDYAAIDGNLAVVNFVLKTFEDHFMSDLSRLDSAMLSSTIERVLRKKKAATLCLLIEAQRVCFRILSWPSFLDIPLFLKENAD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027965`
TK1151 ID	TkA07G109890
OH-1004 ID	LXL04_027965
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 50.832 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027965

Location Chr06:27823373-27826261 (-)

Description Similar to CAS: Exportin-2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g46520`	Export receptor for importin alpha.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027965 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006606 protein import into nucleus Biological Process

GO:0006611 protein export from nucleus Biological Process

GO:0007589 body fluid secretion Biological Process

GO:0005634 nucleus Cellular Component

GO:0005635 nuclear envelope Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009925 basal plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT2G46520

bta:518622

dre:30707

hsa:1434

onl:100534474

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.587

Rank 1 · LXL04_027965 · OH-1004

Cytoplasm0.514

Rank 2 · LXL04_027965 · OH-1004

Mitochondrion0.037

Rank 3 · LXL04_027965 · OH-1004

Endoplasmic reticulum0.037

Rank 4 · LXL04_027965 · OH-1004

Cell membrane0.034

Rank 5 · LXL04_027965 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03810.26IBN_N65-134 aa

PF08506.17Cse1190-517 aa

PF03378.22CAS_CSE1518-950 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027965	`PF03810.26`	IBN_N	65	134	7.2e-09	36.2
LXL04_027965	`PF08506.17`	Cse1	190	517	3.9e-53	181.4
LXL04_027965	`PF03378.22`	CAS_CSE1	518	950	7.1e-84	282.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZPY7`	Arabidopsis thaliana	Exportin-2	43.088%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card