Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1539 bp · LXL04_027779|LXL04_027779|OH1004|cDNA
atGGCACTCATCTTCTCCAAGATAGGCATCATCGGAGGTGGCATAAGCGGCTTAGCGGCGGCCAAACAGCTATCCGAACACAACCCAATAGTGTTAGAAGCCACCGACTCCATTGGAGGTGTTTGGAAGCACTGCGCCTTTAGAACCACCAAACTTCAAACCCCTCGTTGCGACTATGAATTCTCAGATTATCCATGGCCGAATAGGGATAATACCAGCTTCCCGTCGCATGCGGAGATTGTGGATTATCTCAGTTCTTA...
1539 bp · LXL04_027779|LXL04_027779|OH1004|CDS
ATGGCACTCATCTTCTCCAAGATAGGCATCATCGGAGGTGGCATAAGCGGCTTAGCGGCGGCCAAACAGCTATCCGAACACAACCCAATAGTGTTAGAAGCCACCGACTCCATTGGAGGTGTTTGGAAGCACTGCGCCTTTAGAACCACCAAACTTCAAACCCCTCGTTGCGACTATGAATTCTCAGATTATCCATGGCCGAATAGGGATAATACCAGCTTCCCGTCGCATGCGGAGATTGTGGATTATCTCAGTTCTTA...
Protein
Download Protein FASTA512 aa · LXL04_027779|LXL04_027779|OH1004|PROTEIN
MALIFSKIGIIGGGISGLAAAKQLSEHNPIVLEATDSIGGVWKHCAFRTTKLQTPRCDYEFSDYPWPNRDNTSFPSHAEIVDYLSSYAKHFDLFKFIKFNSKVVEIRLAKDQSESPTKLSTLLSAGKPVWEVAVQTTGSAIQWYGFEFIVVCMGKYGDVPIIPKYGMKKGPEVFKGKVMHSQEYSKLNVEESSKLLKDKKVVVVGYKKSGIDLAVECAEANQGEEGKACTMVVRTSHWTVPHYSIWGLPFYLFYSTRFSQ...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_027779 |
|---|---|
| TK1151 ID | TkA07G093630 |
| OH-1004 ID | LXL04_027779 |
| Relationship / confidence | Rbh Sequence Supported / Probable |
| Protein identity (%) | 92.700 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_027779 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr06:23871135-23873885 (-) | |||||||||
| Description | Similar to FMO1: Probable flavin-containing monooxygenase 1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006629 lipid metabolic process Biological Process GO:0006805 xenobiotic metabolic process Biological Process GO:0009626 plant-type hypersensitive response Biological Process GO:0009627 systemic acquired resistance Biological Process GO:0042742 defense response to bacterium Biological Process GO:0050832 defense response to fungus Biological Process GO:0051707 response to other organism Biological Process GO:0062034 L-pipecolic acid biosynthetic process Biological Process GO:0071456 cellular response to hypoxia Biological Process GO:0090181 regulation of cholesterol metabolic process Biological Process GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT1G19250 ath:AT5G45180 mmu:14262 ocu:100009064 rno:246248 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00743.26FMO-like7-486 aaPF01266.31DAO8-61 aaPF13450.13NAD_binding_810-60 aaPF13434.13Lys_Orn_oxgnase71-249 aaPF13738.13Pyr_redox_3148-245 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_027779 | PF00743.26 | FMO-like | 7 | 486 | 8.2e-43 | 147.3 |
| LXL04_027779 | PF01266.31 | DAO | 8 | 61 | 4.9e-06 | 27.0 |
| LXL04_027779 | PF13450.13 | NAD_binding_8 | 10 | 60 | 1.4e-06 | 29.1 |
| LXL04_027779 | PF13434.13 | Lys_Orn_oxgnase | 71 | 249 | 3.3e-07 | 30.5 |
| LXL04_027779 | PF13738.13 | Pyr_redox_3 | 148 | 245 | 8.5e-12 | 45.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.