LXL04_027767 | RubberDandelionOmics

Gene overview

LXL04_027767

Reference: OH-1004 Chr: Chr06 Coordinates: 23651604-23660291 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3465 bp · LXL04_027767|LXL04_027767|OH1004|cDNA

ATGGTAATGGGGGTGATGGAAGGCTCTGATGCATTACATCCAAGTCAAGGTATGAGAGAAGTTGACAAACAATTTCTAGCTGCTCCTGTGAAGTCTGCTGTTGATAAGTTTCAGTTAGTTCCTGAGTTTATCAAGGTGAGGGGATTGGTGAAGGAACATTTGGActcttttaattattttatcacGACTGATATAAAGAAGATTGTTGAGGCTAATAACTTTGTGAGATGTACTTTCGATGATAAGGTCTATCTCAGATA...

CDS

Download CDS FASTA

3465 bp · LXL04_027767|LXL04_027767|OH1004|CDS

ATGGTAATGGGGGTGATGGAAGGCTCTGATGCATTACATCCAAGTCAAGGTATGAGAGAAGTTGACAAACAATTTCTAGCTGCTCCTGTGAAGTCTGCTGTTGATAAGTTTCAGTTAGTTCCTGAGTTTATCAAGGTGAGGGGATTGGTGAAGGAACATTTGGACTCTTTTAATTATTTTATCACGACTGATATAAAGAAGATTGTTGAGGCTAATAACTTTGTGAGATGTACTTTCGATGATAAGGTCTATCTCAGATA...

Protein

Download Protein FASTA

1154 aa · LXL04_027767|LXL04_027767|OH1004|PROTEIN

MVMGVMEGSDALHPSQGMREVDKQFLAAPVKSAVDKFQLVPEFIKVRGLVKEHLDSFNYFITTDIKKIVEANNFVRCTFDDKVYLRYLKVSVGKPSVVKDGITDEMNPQQCRLGEMTYSAPICVDIEYCNGSYGHIVHPQVKKGVVIGRMPIMLRSSHCVLFGKDEEELAKLGECPLDPGGYFVVKGNEKVILIQEQLSKNRIIIDKDKKGCIQASIMSSTSMTKAKTTLVMEKEKIYLNLNSFTSKVPIMVVMKAMGME...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027767`
TK1151 ID	TkA07G093070
OH-1004 ID	LXL04_027767
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027767

Location Chr06:23651604-23660291 (+)

Description Similar to NRPC2: DNA-directed RNA polymerase III subunit 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g45140`	DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027767 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006354 DNA-templated transcription elongation Biological Process

GO:0006383 transcription by RNA polymerase III Biological Process

GO:0006384 transcription initiation at RNA polymerase III promoter Biological Process

GO:0006386 termination of RNA polymerase III transcription Biological Process

GO:0009303 rRNA transcription Biological Process

GO:0009561 megagametogenesis Biological Process

GO:0032728 positive regulation of interferon-beta production Biological Process

GO:0042796 snRNA transcription by RNA polymerase III Biological Process

GO:0042797 tRNA transcription by RNA polymerase III Biological Process

GO:0045087 innate immune response Biological Process

GO:0045089 positive regulation of innate immune response Biological Process

GO:0051607 defense response to virus Biological Process

KEGG gene cross-reference

ath:AT5G45140

hsa:55703

mmu:70428

sce:YOR207C

spo:2543393

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.940

Rank 1 · LXL04_027767 · OH-1004

Cytoplasm0.086

Rank 2 · LXL04_027767 · OH-1004

Mitochondrion0.025

Rank 3 · LXL04_027767 · OH-1004

Cell membrane0.019

Rank 4 · LXL04_027767 · OH-1004

Endoplasmic reticulum0.009

Rank 5 · LXL04_027767 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04563.21RNA_pol_Rpb2_148-427 aa

PF04561.20RNA_pol_Rpb2_2200-378 aa

PF04565.22RNA_pol_Rpb2_3454-518 aa

PF04566.19RNA_pol_Rpb2_4555-615 aa

PF04567.23RNA_pol_Rpb2_5637-668 aa

PF00562.34RNA_pol_Rpb2_6684-1058 aa

PF04560.26RNA_pol_Rpb2_71060-1150 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027767	`PF04563.21`	RNA_pol_Rpb2_1	48	427	5.7e-51	173.7
LXL04_027767	`PF04561.20`	RNA_pol_Rpb2_2	200	378	5.4e-20	72.6
LXL04_027767	`PF04565.22`	RNA_pol_Rpb2_3	454	518	1.5e-18	67.4
LXL04_027767	`PF04566.19`	RNA_pol_Rpb2_4	555	615	4.9e-24	84.9
LXL04_027767	`PF04567.23`	RNA_pol_Rpb2_5	637	668	1e-06	30.2
LXL04_027767	`PF00562.34`	RNA_pol_Rpb2_6	684	1058	4.6e-135	451.2
LXL04_027767	`PF04560.26`	RNA_pol_Rpb2_7	1060	1150	6.3e-31	107.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4KD38`	Arabidopsis thaliana	DNA-directed RNA polymerase III subunit 2	70.409%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card