LXL04_027758 | RubberDandelionOmics

Gene overview

LXL04_027758

Reference: OH-1004 Chr: Chr06 Coordinates: 23358586-23362303 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2583 bp · LXL04_027758|LXL04_027758|OH1004|cDNA

ATGGCAGCAAAGAAGGAAGTTATAAACCCTAAAGCCATTATACACCAAAGATTTGGGGATAAAGCGCATTACAACATAGAAGAAATTCAAGAATTCTCATCGAATGGATGTCCTGGCCTTTCTATTACACAAAAAGGTCCATGCCTATACCGTTGCTGCCTGCAACTTCCAGATTTTTCCGTCGTGTCAGAGGTTTTTAAGCGAAAAAAAGATGCTATGCAATCTGCTGCAGAAAAAGCCCTAGAAAAGTTAACCGACCC...

CDS

Download CDS FASTA

2583 bp · LXL04_027758|LXL04_027758|OH1004|CDS

ATGGCAGCAAAGAAGGAAGTTATAAACCCTAAAGCCATTATACACCAAAGATTTGGGGATAAAGCGCATTACAACATAGAAGAAATTCAAGAATTCTCATCGAATGGATGTCCTGGCCTTTCTATTACACAAAAAGGTCCATGCCTATACCGTTGCTGCCTGCAACTTCCAGATTTTTCCGTCGTGTCAGAGGTTTTTAAGCGAAAAAAAGATGCTATGCAATCTGCTGCAGAAAAAGCCCTAGAAAAGTTAACCGACCC...

Protein

Download Protein FASTA

860 aa · LXL04_027758|LXL04_027758|OH1004|PROTEIN

MAAKKEVINPKAIIHQRFGDKAHYNIEEIQEFSSNGCPGLSITQKGPCLYRCCLQLPDFSVVSEVFKRKKDAMQSAAEKALEKLTDPPVENPSDQLVSRLSYLFSNEFYATCHPLSGHFRAALHREGDLKGFVPISLMPIYDSKISNLCKSIKPEVELKPFEVTSLIMEASGRLPDSVFGSKEHSSLKRVTPYPPEVLQSVEISCEEETYVKAIRVPYLVNKSVDSLTIDVSSNKYYMDAIAKELGVSDASRIMLSRGIG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027758`
TK1151 ID	TkA07G091620
OH-1004 ID	LXL04_027758
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027758

Location Chr06:23358586-23362303 (+)

Description Similar to HEN1: Small RNA 2'-O-methyltransferase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g20910`	Methyltransferase that adds a methyl group to the ribose of the last nucleotide of small RNAs (sRNAs).	HEN1 functions pleiotropically in Arabidopsis development and acts in C function in the flower.2002 · DOI: 10.1242/dev.129.5.1085 Formation of corymb-like inflorescences due to delay in bolting and flower development in the corymbosa2 mutant of Arabidopsis.2002 · DOI: 10.1093/pcp/pcf036 Methylation protects miRNAs and siRNAs from a 3'-end uridylation activity in Arabidopsis.2005 · DOI: 10.1016/j.cub.2005.07.029

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027758 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001510 RNA methylation Biological Process

GO:0009616 RNAi-mediated antiviral immune response Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0010093 specification of floral organ identity Biological Process

GO:0010267 ta-siRNA processing Biological Process

GO:0010305 leaf vascular tissue pattern formation Biological Process

GO:0010589 leaf proximal/distal pattern formation Biological Process

GO:0030422 siRNA processing Biological Process

GO:0035196 miRNA processing Biological Process

GO:0035279 miRNA-mediated gene silencing by mRNA destabilization Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT4G20910

hsa:113802

mcf:102140180

rno:100363095

xtr:100286818

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.601

Rank 1 · LXL04_027758 · OH-1004

Cytoplasm0.409

Rank 2 · LXL04_027758 · OH-1004

Mitochondrion0.069

Rank 3 · LXL04_027758 · OH-1004

Cell membrane0.055

Rank 4 · LXL04_027758 · OH-1004

Endoplasmic reticulum0.044

Rank 5 · LXL04_027758 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24995.2DSRM_215-85 aa

PF21224.4Hen1_LCD93-194 aa

PF18441.7Hen1_Lam_C211-338 aa

PF17842.8dsRBD2340-397 aa

PF17842.8dsRBD2392-446 aa

PF08242.19Methyltransf_12636-735 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027758	`PF24995.2`	DSRM_2	15	85	8.1e-11	43.0
LXL04_027758	`PF21224.4`	Hen1_LCD	93	194	9e-34	116.8
LXL04_027758	`PF18441.7`	Hen1_Lam_C	211	338	1.2e-48	165.1
LXL04_027758	`PF17842.8`	dsRBD2	340	397	2.5e-44	151.6
LXL04_027758	`PF17842.8`	dsRBD2	392	446	2.5e-44	151.6
LXL04_027758	`PF08242.19`	Methyltransf_12	636	735	1.5e-06	29.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C5Q8`	Arabidopsis thaliana	Small RNA 2'-O-methyltransferase	45.319%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card