LXL04_027734 | RubberDandelionOmics

Gene overview

LXL04_027734

Reference: OH-1004 Chr: Chr06 Coordinates: 22787716-22788861 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

834 bp · LXL04_027734|LXL04_027734|OH1004|cDNA

ATGGAAGGGCGTAAGCATTTTAGCCATCCACACAATCTTTCTTTCCACAAAAGCTTAGAAGGTGCACAACTCACTTGTACCGGCTGCAACTTCCCTTGTACCGGCACTCCGGTCTACTCCTGCCGCCGTTGCAAATTCTTCCTCCACGACCAATGCTTCAATGCCGCAAGATCACTGATCCATCCATCACACCCCGCTCACCCTCTCTCGTTATTCCCTTCTTCAACGTACTCCGGCGGTTCTTTCATCTGCAGCTCGTG...

CDS

Download CDS FASTA

834 bp · LXL04_027734|LXL04_027734|OH1004|CDS

ATGGAAGGGCGTAAGCATTTTAGCCATCCACACAATCTTTCTTTCCACAAAAGCTTAGAAGGTGCACAACTCACTTGTACCGGCTGCAACTTCCCTTGTACCGGCACTCCGGTCTACTCCTGCCGCCGTTGCAAATTCTTCCTCCACGACCAATGCTTCAATGCCGCAAGATCACTGATCCATCCATCACACCCCGCTCACCCTCTCTCGTTATTCCCTTCTTCAACGTACTCCGGCGGTTCTTTCATCTGCAGCTCGTG...

Protein

Download Protein FASTA

277 aa · LXL04_027734|LXL04_027734|OH1004|PROTEIN

MEGRKHFSHPHNLSFHKSLEGAQLTCTGCNFPCTGTPVYSCRRCKFFLHDQCFNAARSLIHPSHPAHPLSLFPSSTYSGGSFICSSCNQIGSGLCFCCSVCEFDLHIHCAYNDLKPNSGDPNLPPKKIQIKAHPNHPLIYLPKPPYQNGTENECWCDVCGTICDPNGGLYNCGSCGEAISQKHCMYYCNSGCDYGVHVQCVGAKVSEKAPAPAMDAMTFQLEMFMLQNKVKLNQMVVDTMQMGSHGLHRFDYDRRFTFLV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027734`
TK1151 ID	TkA07G089420
OH-1004 ID	LXL04_027734
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	84.000
Protein coverage (%)	TK1151 100.000 / OH-1004 87.004 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027734

Location Chr06:22787716-22788861 (+)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g17740`	Essential for development of both female (megagametogenesis) and male (microgametogenesis) gametophytes by promoting the formation of large vacuoles early in development, maybe via the regulation of vesicular fusion.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027734 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002237 response to molecule of bacterial origin Biological Process

GO:0002238 response to molecule of fungal origin Biological Process

GO:0002240 response to molecule of oomycetes origin Biological Process

GO:0009561 megagametogenesis Biological Process

GO:0009617 response to bacterium Biological Process

GO:0055046 microgametogenesis Biological Process

GO:0005634 nucleus Cellular Component

GO:0005771 multivesicular body Cellular Component

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G17740

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.634

Rank 1 · LXL04_027734 · OH-1004

Nucleus0.400

Rank 2 · LXL04_027734 · OH-1004

Cell membrane0.087

Rank 3 · LXL04_027734 · OH-1004

Endoplasmic reticulum0.086

Rank 4 · LXL04_027734 · OH-1004

Mitochondrion0.059

Rank 5 · LXL04_027734 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03107.23C1_27-52 aa

PF03107.23C1_262-110 aa

PF03107.23C1_2132-179 aa

PF03107.23C1_2167-201 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027734	`PF03107.23`	C1_2	7	52	2.2e-25	89.4
LXL04_027734	`PF03107.23`	C1_2	62	110	2.2e-25	89.4
LXL04_027734	`PF03107.23`	C1_2	132	179	2.2e-25	89.4
LXL04_027734	`PF03107.23`	C1_2	167	201	2.2e-25	89.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6NQN8`	Arabidopsis thaliana	Protein VACUOLELESS GAMETOPHYTES	29.469%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card