LXL04_027723 | RubberDandelionOmics

Gene overview

LXL04_027723

Reference: OH-1004 Chr: Chr06 Coordinates: 22537948-22538157 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

210 bp · LXL04_027723|LXL04_027723|OH1004|cDNA

ATGTGGAAGTTGAAGATAGCAGAAGGAAATGATCCTTACCTATTTTCCACAAACAATTTTGTTGGCCGACAAATTTGGGAATTTGATCCCGATGCTGGAACACCGACGGAGCGTCAAGAAGTAGAAGATGCTCGCCAGTATTATCAAGATAATCGAAAGAAGGGTGTTCATCCATGTGGTGATTTGCTTATGCGGGTGCAGGTTAGTTAG

CDS

Download CDS FASTA

210 bp · LXL04_027723|LXL04_027723|OH1004|CDS

ATGTGGAAGTTGAAGATAGCAGAAGGAAATGATCCTTACCTATTTTCCACAAACAATTTTGTTGGCCGACAAATTTGGGAATTTGATCCCGATGCTGGAACACCGACGGAGCGTCAAGAAGTAGAAGATGCTCGCCAGTATTATCAAGATAATCGAAAGAAGGGTGTTCATCCATGTGGTGATTTGCTTATGCGGGTGCAGGTTAGTTAG

Protein

Download Protein FASTA

69 aa · LXL04_027723|LXL04_027723|OH1004|PROTEIN

MWKLKIAEGNDPYLFSTNNFVGRQIWEFDPDAGTPTERQEVEDARQYYQDNRKKGVHPCGDLLMRVQVS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027723`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027723

Location Chr06:22537948-22538157 (+)

Description Similar to DDS: Dammarenediol II synthase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g78960`	Multifunctional enzyme that converts oxidosqualene to nine different triterpenes, mainly lupeol, beta-amyrin and alpha-amyrin in a 15:50:30 ratio.	Molecular cloning and expression in yeast of 2,3-oxidosqualene-triterpenoid cyclases from Arabidopsis thaliana.2001 · DOI: 10.1023/a:1006476123930

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027723 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002238 response to molecule of fungal origin Biological Process

GO:0010038 response to metal ion Biological Process

GO:0016104 triterpenoid biosynthetic process Biological Process

GO:0016135 saponin biosynthetic process Biological Process

GO:0019745 pentacyclic triterpenoid biosynthetic process Biological Process

GO:1902438 response to vanadate(3-) Biological Process

GO:0005634 nucleus Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005811 lipid droplet Cellular Component

GO:0016829 lyase activity Molecular Function

GO:0042299 lupeol synthase activity Molecular Function

GO:0042300 beta-amyrin synthase activity Molecular Function

KEGG gene cross-reference

ag:BAF33291

ag:BAF80441

ath:AT1G78960

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.353

Rank 1 · LXL04_027723 · OH-1004

Nucleus0.317

Rank 2 · LXL04_027723 · OH-1004

Cytoplasm0.305

Rank 3 · LXL04_027723 · OH-1004

Mitochondrion0.066

Rank 4 · LXL04_027723 · OH-1004

Cell membrane0.037

Rank 5 · LXL04_027723 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RWT0`	Arabidopsis thaliana	Amyrin synthase LUP2	71.014%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card