LXL04_027722 | RubberDandelionOmics

Gene overview

LXL04_027722

Reference: OH-1004 Chr: Chr06 Coordinates: 22525979-22526587 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

414 bp · LXL04_027722|LXL04_027722|OH1004|cDNA

ATGTCCGATGAAAGGGCAAGAATGTTGCAAGATCAATTCAATGTCAGCATGAATCATGTTCACGCTTTGGCTATTCTCGTTTCCACTTTTTACCATGGGAAagatcctcctgctattgatCAAGTAATCTTCTTTCATAATCCCGATATCATAATCTCTGACGATAATTTGACAGTAGAGTTTCCCCCATCGTTAGCTGCAGTATCGGCAGCAGAGGCGGCGGACGGCGATCACACCGCTATTCCGCTAACCTCCTGCAA...

CDS

Download CDS FASTA

414 bp · LXL04_027722|LXL04_027722|OH1004|CDS

ATGTCCGATGAAAGGGCAAGAATGTTGCAAGATCAATTCAATGTCAGCATGAATCATGTTCACGCTTTGGCTATTCTCGTTTCCACTTTTTACCATGGGAAAGATCCTCCTGCTATTGATCAAGTAATCTTCTTTCATAATCCCGATATCATAATCTCTGACGATAATTTGACAGTAGAGTTTCCCCCATCGTTAGCTGCAGTATCGGCAGCAGAGGCGGCGGACGGCGATCACACCGCTATTCCGCTAACCTCCTGCAA...

Protein

Download Protein FASTA

137 aa · LXL04_027722|LXL04_027722|OH1004|PROTEIN

MSDERARMLQDQFNVSMNHVHALAILVSTFYHGKDPPAIDQVIFFHNPDIIISDDNLTVEFPPSLAAVSAAEAADGDHTAIPLTSCNDDAVSGRADLNFMKPSILEKKCRADISKQEFEKAKEAEAIGFVLNGIVND

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027722`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027722

Location Chr06:22525979-22526587 (+)

Description Similar to HK5: Probable histidine kinase 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g35750`	Cytokinins (CK) receptor related to bacterial two-component regulators.	Histidine kinase homologs that act as cytokinin receptors possess overlapping functions in the regulation of shoot and root growth in Arabidopsis.2004 · DOI: 10.1105/tpc.021477 In planta functions of the Arabidopsis cytokinin receptor family.2004 · DOI: 10.1073/pnas.0402887101 Arabidopsis cytokinin receptor mutants reveal functions in shoot growth, leaf senescence, seed size, germination, root development, and cytokinin metabolism.2006 · DOI: 10.1105/tpc.105.037796 Cytokinins regulate a bidirectional phosphorelay network in Arabidopsis.2006 · DOI: 10.1016/j.cub.2006.04.030 Identification of amino acid substitutions that render the Arabidopsis cytokinin receptor histidine kinase AHK4 constitutively active.2007 · DOI: 10.1093/pcp/pcm145 Cytokinin receptors are involved in alkamide regulation of root and shoot development in Arabidopsis.2007 · DOI: 10.1104/pp.107.107953 Functional analysis of AHK1/ATHK1 and cytokinin receptor histidine kinases in response to abscisic acid, drought, and salt stress in Arabidopsis.2007 · DOI: 10.1073/pnas.0706547105 The role of auxins and cytokinins in the mutualistic interaction between Arabidopsis and Piriformospora indica.2008 · DOI: 10.1094/mpmi-21-10-1371 The histidine kinases CYTOKININ-INDEPENDENT1 and ARABIDOPSIS HISTIDINE KINASE2 and 3 regulate vascular tissue development in Arabidopsis shoots.2009 · DOI: 10.1105/tpc.109.066696 Cytokinin overproduction-caused alteration of flower development is partially mediated by CUC2 and CUC3 in Arabidopsis.2010 · DOI: 10.1016/j.gene.2009.11.003 A subset of cytokinin two-component signaling system plays a role in cold temperature stress response in Arabidopsis.2010 · DOI: 10.1074/jbc.m109.096644
`At1g27320`	Cytokinins (CK) receptor related to bacterial two-component regulators.	Novel family of sensor histidine kinase genes in Arabidopsis thaliana.2001 · DOI: 10.1093/pcp/pce015 The Arabidopsis AHK4 histidine kinase is a cytokinin-binding receptor that transduces cytokinin signals across the membrane.2001 · DOI: 10.1093/pcp/pce127 Histidine kinase homologs that act as cytokinin receptors possess overlapping functions in the regulation of shoot and root growth in Arabidopsis.2004 · DOI: 10.1105/tpc.021477 In planta functions of the Arabidopsis cytokinin receptor family.2004 · DOI: 10.1073/pnas.0402887101 Two cytokinin receptors of Arabidopsis thaliana, CRE1/AHK4 and AHK3, differ in their ligand specificity in a bacterial assay.2004 · DOI: 10.1093/pcp/pch132 Interaction between phosphate-starvation, sugar, and cytokinin signaling in Arabidopsis and the roles of cytokinin receptors CRE1/AHK4 and AHK3.2005 · DOI: 10.1104/pp.105.060517 Arabidopsis cytokinin receptor mutants reveal functions in shoot growth, leaf senescence, seed size, germination, root development, and cytokinin metabolism.2006 · DOI: 10.1105/tpc.105.037796 Cytokinin-mediated control of leaf longevity by AHK3 through phosphorylation of ARR2 in Arabidopsis.2006 · DOI: 10.1073/pnas.0505150103 Cytokinins regulate a bidirectional phosphorelay network in Arabidopsis.2006 · DOI: 10.1016/j.cub.2006.04.030 Biochemical characteristics and ligand-binding properties of Arabidopsis cytokinin receptor AHK3 compared to CRE1/AHK4 as revealed by a direct binding assay.2006 · DOI: 10.1093/jxb/erl179 Identification of amino acid substitutions that render the Arabidopsis cytokinin receptor histidine kinase AHK4 constitutively active.2007 · DOI: 10.1093/pcp/pcm145 Cytokinin receptors are involved in alkamide regulation of root and shoot development in Arabidopsis.2007 · DOI: 10.1104/pp.107.107953 Functional analysis of AHK1/ATHK1 and cytokinin receptor histidine kinases in response to abscisic acid, drought, and salt stress in Arabidopsis.2007 · DOI: 10.1073/pnas.0706547105 Cytokinins negatively regulate the root iron uptake machinery in Arabidopsis through a growth-dependent pathway.2008 · DOI: 10.1111/j.1365-313x.2008.03502.x Mechanism-based inhibitors of cytokinin oxidase/dehydrogenase attack FAD cofactor.2008 · DOI: 10.1016/j.jmb.2008.05.044 The histidine kinases CYTOKININ-INDEPENDENT1 and ARABIDOPSIS HISTIDINE KINASE2 and 3 regulate vascular tissue development in Arabidopsis shoots.2009 · DOI: 10.1105/tpc.109.066696 Cytokinin overproduction-caused alteration of flower development is partially mediated by CUC2 and CUC3 in Arabidopsis.2010 · DOI: 10.1016/j.gene.2009.11.003 A subset of cytokinin two-component signaling system plays a role in cold temperature stress response in Arabidopsis.2010 · DOI: 10.1074/jbc.m109.096644

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0362300`	Cytokinin receptor related to bacterial two-component regulators.	No verified direct reference in this release
`Os01g0923700`	Cytokinin receptor related to bacterial two-component regulators.	No verified direct reference in this release
`UniProt: A2WYI4`	Cytokinin receptor related to bacterial two-component regulators.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027722 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006970 response to osmotic stress Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009636 response to toxic substance Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009736 cytokinin-activated signaling pathway Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0010029 regulation of seed germination Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0010150 leaf senescence Biological Process

GO:0010271 regulation of chlorophyll catabolic process Biological Process

KEGG gene cross-reference

ath:AT1G27320

ath:AT5G35750

dosa:Os01g0923700

dosa:Os10g0362300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.460

Rank 1 · LXL04_027722 · OH-1004

Cytoplasm0.343

Rank 2 · LXL04_027722 · OH-1004

Cell membrane0.088

Rank 3 · LXL04_027722 · OH-1004

Mitochondrion0.079

Rank 4 · LXL04_027722 · OH-1004

Extracellular0.073

Rank 5 · LXL04_027722 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C5U2`	Arabidopsis thaliana	Histidine kinase 2	79.545%	Swiss-Prot	weak database homology
`Q9C5U1`	Arabidopsis thaliana	Histidine kinase 3	71.429%	Swiss-Prot	weak database homology
`A1A697`	Oryza sativa subsp. japonica	Probable histidine kinase 5	86.364%	Swiss-Prot	weak database homology
`A1A696`	Oryza sativa subsp. japonica	Probable histidine kinase 3	79.545%	Swiss-Prot	weak database homology
`A2WYI4`	Oryza sativa subsp. indica	Probable histidine kinase 3	79.545%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card