LXL04_027714 | RubberDandelionOmics

Gene overview

LXL04_027714

Reference: OH-1004 Chr: Chr06 Coordinates: 22341887-22347413 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1371 bp · LXL04_027714|LXL04_027714|OH1004|cDNA

ATGGTTGATGATGGGGTGGCCGGGAAAGAGTCTTTGACGGTGGCTGTAGGGAGGGGATCCGTCTTCTTTTATGGCGTCGGACATATGCTCAACGACATAACGGCTGCCTGCTGGTTTACTTATCTTTTGGTTTTCATGACGGATATCGGATTATCCCCCAGGAATGCTGCTACGGTCATGCTTTCTGGTCAGATAGCAGATGGATTCACTACCATTTTTGCTGGCGAACTGATAGACAGGTTCGGACATTTTAAGGTTTG...

CDS

Download CDS FASTA

1371 bp · LXL04_027714|LXL04_027714|OH1004|CDS

ATGGTTGATGATGGGGTGGCCGGGAAAGAGTCTTTGACGGTGGCTGTAGGGAGGGGATCCGTCTTCTTTTATGGCGTCGGACATATGCTCAACGACATAACGGCTGCCTGCTGGTTTACTTATCTTTTGGTTTTCATGACGGATATCGGATTATCCCCCAGGAATGCTGCTACGGTCATGCTTTCTGGTCAGATAGCAGATGGATTCACTACCATTTTTGCTGGCGAACTGATAGACAGGTTCGGACATTTTAAGGTTTG...

Protein

Download Protein FASTA

456 aa · LXL04_027714|LXL04_027714|OH1004|PROTEIN

MVDDGVAGKESLTVAVGRGSVFFYGVGHMLNDITAACWFTYLLVFMTDIGLSPRNAATVMLSGQIADGFTTIFAGELIDRFGHFKVWHGAGSILVAVSFSSVFGGCVPCIIFGSESTLLQTIGYSFFAAVFNVGWAATQVSHMSMVNCITLNSTSRVVLTSCRNAFSMVANLSLYAVAFSVFHVWPSKTTEEVKNQYRWIAYSSIFIGCFFVVVFHIGTKEPRLKEDFREHGHQKLAWTYWFKKVLYYQVALVYVFARLI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027714`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_027714`
Location	Chr06:22341887-22347413 (-)
Description	Similar to MFSD12: Major facilitator superfamily domain-containing protein 12
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_027714` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0000380 alternative mRNA splicing, via spliceosome Biological Process GO:0008643 carbohydrate transport Biological Process GO:0042438 melanin biosynthetic process Biological Process GO:0043474 pigment metabolic process involved in pigmentation Biological Process GO:0048021 regulation of melanin biosynthetic process Biological Process GO:0048022 negative regulation of melanin biosynthetic process Biological Process GO:1903712 cysteine transmembrane transport Biological Process GO:0005737 cytoplasm Cellular Component GO:0005764 lysosome Cellular Component GO:0005765 lysosomal membrane Cellular Component GO:0005770 late endosome Cellular Component GO:0005886 plasma membrane Cellular Component
KEGG gene cross-reference	hsa:126321 mmu:73822 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.395

Rank 1 · LXL04_027714 · OH-1004

Cell membrane0.319

Rank 2 · LXL04_027714 · OH-1004

Cytoplasm0.230

Rank 3 · LXL04_027714 · OH-1004

Endoplasmic reticulum0.115

Rank 4 · LXL04_027714 · OH-1004

Golgi apparatus0.113

Rank 5 · LXL04_027714 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13347.13MFS_223-444 aa

PF07690.22MFS_128-375 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027714	`PF13347.13`	MFS_2	23	444	2.6e-17	63.2
LXL04_027714	`PF07690.22`	MFS_1	28	375	1.5e-10	41.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card